Join devRant
Do all the things like
++ or -- rants, post your own rants, comment on others' rants and build your customized dev avatar
Sign Up
Pipeless API
From the creators of devRant, Pipeless lets you power real-time personalized recommendations and activity feeds using a simple API
Learn More
Search - "open back"
-
*listens to music using Samsung earphones*
Person next to me: Nice song
Neighbor: Nice song
Aliens: Nice song14 -
Senior IT engineer enters the room and quietly talks to a coworker about a job related issue.
Another coworker decided to troll the sysadmin.
CW: *yells* "Open a ticket!" (That's the sysadmin's regular reply)
IT: *ignores*
CW: *trying to get his attention* "Open a ticket first! Then come back"
IT: *gives him the stare of death*
CW: "Go away and open a ticket!"
IT: *silently leaves the room*
After no more than a minute CW gets a reject from all networks outside the company's VPN.
IT comes back into the room, get's intimately close to CW's ear and says "Now open a ticket".
👋
🎤9 -
My girlfriend's dad asked me to fix his printer.
I open it up, pulled the cartridge, blowed some air and put it back again.
It worked.
He now thinks I am a genius.15 -
When you accidently open the bios menu on your smart watch when you're just trying to turn it back on 😂13
-
I had just started my new job and deleted 3 years of data that the client had spent over £450,000 collecting 😱
another developer used my PC to quickly access the clients database while I was out the room as I had sql management studio open. I went back to my PC thinking I was connected to my local database, did a few truncate tables to test my software and :0 minutes later I get a call asking why there was no data on the server!
Thank god for backups 😓7 -
Someones keyboard just stopped working in my job.
They called the helpdesk and i told them to unplug the keyboard from the back of the PC and try a different usb port before i send them down a new keyboard.
Their reply?
‘How am i meant to do that? I mean... *laughs* I didn’t go to college for this kind of stuff. I know you did but you need to explain it in English for me instead of using technical terms.’
....
So i had to describe what a USB looks like, and tell her how to follow the (only) skinny black cable she has on her desk, down the back of the desk and into the PC. She got overwhelmed by this cable being the same colour as the thicker VGA cable, so ended up unplugging everything!
Its fine though, as when she plugged them all back in, everything was back working.
She finished the call by saying:
“Like, i know how to use a computer but I just don’t understand all this technical mumbo jumbo, like USB’s and stuff? How should i know about that?”
...
I sincerely think interviews need to have just 5 minutes dedicated to the person showing that they know what a bloody USB is!!, can turn on/off a PC, open outlook, and follow basic instructions.
Ugh I work with idiots 😢17 -
*during my final job interview*
*holding the folder that contains my cv*
interviewer: Wait, before I open this I would like to guess which position you're applying to.
me: Hmm okay sir? Which position?
interviewer: I see you're applying as a back-end developer?
me: Yes sir, I am.
interviewer: Aha! That's because you have a long hair? Like it is a requirement for every devs to grow their hair?
me: *laughs* i think so?
interviewer: Well our devs here also has long hair. You'll meet 'em soon.
...
That sets the mood of my interviewing process that leads me the job offer. LOL.13 -
*on the phone with a client*
Important detail: in Dutch we call a colon a "double point" and a semicolon a "point comma".
Me: go to {url} and put double point followed by {something} behind it.
Client: *tries for 5 minutes, suggestions forth and back*
Me: how did you type the double points?
Client: I typed two points. (..)
The level of retardness I thought existed got worse once again.
At that moment the open window seemed like a veeery good option 😭15 -
My boss literally spends half an hour finger-fucking his phone on the mobile site to find "bugs", that I can't replicate. A combination like: swipe, pinch, landscape, portrait, back pinch, open new tab, close tab, ash cigarette on phone, dunk in toilet, dry, double tap... Aha I've found a bug, there's 0.5 pixel line of space between the bag header and the browser bar.14
-
The day I send myself about 76k mails
> be me
> be working on a rest api
> implement an error handler that would send me a mail with exception details
> use same error handler in mail send error handler
> Summoned the recursion devil by accident
> Test error handler
> Forgot port forwarding to SMTP server
> keep the debug session open
> throw new UnexpectedInterruptionException()
> get back to work
> Add the missing port forwarding rule to putty
> The error handler starts doing it's thing
> The handler chain starts to pop
> handler after handler executes
> PCFreeze.png
> WhatTheFuckIsGoingOn.gif
> VS finally accepts stop debugging
> PhoneVibrationSpam.mp3
> Peek into webmail
> WowFinallySomeFanMail
> Look into it
> Realizing what I have done
> Delete mailbox
> Remove recursion
> Wow that's how randy must have felt in southpark
> Feel weird
> Shutdown, go outside
> What's up anon?
> Nothing, really6 -
I worked at a place where the help desk guys did the good ol' "I'll send an email from your laptop if you walk away without locking it and tell everyone lunch is on you" routine. After it happened to me about 3 times I was like, "I gotta get this help desk prick back!" So after several failed attempts at walking by his pc when he walked away it instantly hit me how I can punk him back.....SO, I logged onto SQL Server, clicked open a new query window and typed up a dbmail command and on the @from parameter I set it to the help desk guy's email address. His face was PRICELESS when I was shooting off emails to the entire IT dept on behalf of him WHILE he was sitting in front of his PC. Lesson is: don't fuck with dev help desk dude! 😎😜2
-
Sister comes into my room
"Can you look at moms laptop, it stopped working I'm scared I broke it"
Ask why
"Idk it just stopped working, all I did was install adobe flash player I dont think that could do it could it?"
Top kek
Take a look
"EFI IPV4 0 (error code) failed to boot"
Weird. Enter bios
"Hard drive: [Not detected]"
Well, that's no bueno
Pop open back, hard drive is loose
Pfft, push that fucker back in
Boot -> works
"Mom is going to kill me I broke it im so worried" -> relieved laughter
Adobeflashplayerkilledmyharddrive.jpg
Shook.exe14 -
Fucking fuck.
Females in QA always use a hand lotion or a creme, so every damn door handle and every test device is constantly oily and moist.
I've told them multiple times that it needs to stop but they only told me I was pathetic (maybe I am), now finally few others also started noticing that any phone in their hand slips away every time.
Even after using a restroom and grabbing the doorknob of our office I need to go back, wash my hands again and then open the door with a napkin.
I hate dirty things and ignorant coworkers who don't give a fuck about others. I'll start wearing gloves probably.7 -
I wonder if those people who give unwarranted useless advice to developers go to their doctors and do the same thing.
- Doc, just make a small slit, take out old heart, put in a new one, connect everything back as before and stitch it. Easy peasy. Shouldn't take more than a few minutes.
- my leg is fractured. Just open it and tape it back. It is a hack job, but it'll make the client happy for now. It will be quickly done.
- I think I have cancer. Just write a script to kill it. Shouldn't be too difficult.
Fuckers.4 -
I hate Munich. Instead of using Windows, the city administration had built their own Linux distro called LiMux for all of the ~30000 city's computers. They invested years into developing it, because, hey, it's open source! Now they used it for four years, and just as Microsoft opens an office in town, they throw it all overboard and go back to Windows. Why? Because, umm, they can't even use MS Word, what all the others use and such.
This is such a bullshit. You had a good thing going here, in times of NSA surveillance and monopolies. Munich is such a capitalistic town. I'm happy to have moved out of it for good.13 -
YouTube: you want 3 months of free YouTube premium? YouTube originals!!!
*Closes YouTube app and returns to Yatse to control my Kodi installation*
*Returns back to the YouTube app*
YouTube: oh, did you ever wish that you could play videos in the background?!
FUCK NO!!! I've got NewPipe and youtube-dl for that!!! The latter even combines nicely with my BlackPlayer EX!!!
Open source is amazing. The ability to just say no to those profiteering gluttons because you already have what they're offering as a "premium feature". Fucking awesome!9 -
I have what seems to be an unpopular opinion about buying software as a software developer.
First off, I support open source all the way. There should always be free and open tools for people to use if the need or want to.
Second, if you underpaid, broke, unemployed, or a student then this doesn’t apply to you. You keep pushing forward!
With that said, let’s get to the meat of it all...
I pay for good software. Even when it is expensive. Even when there are “workable” free or open source solutions.
I do this for a number of reasons...
1. They are better, hands down.
(Tower > GitKraken, SourceTree, GitHub Desktop) (Kalidascope > every other diff tool) (JetBrains IDEs > Atom, Brackets ...)
2. I’m no longer a broke student. I make enough money to buy them.
3. Most important: I’m a fucking professional software developer, not a fucking joker.
- If I was a carpenter then I could always hammer nails with the back of my work boot. It’s free and paid for and will do the job. Instead I would buy a good hammer because I’d be a professional and not a fucking joker complaining about the price of the tools to do my job.
4. I use a Mac, sometimes Linux and NEVER Windows. Which means I have a platform that actually has useful apps built for developers who are willing to pay for it.
5. I don’t get caught up in developer circle jerks about how all development software should be open source and free.
————
So there you go.
Does this offend you?
Good!
Come at me bro23 -
I have 2 screens @ my desk with my back facing manager's room. Whenever he opens his door, he can see my second screen.
Thinking of a side project based on webcam that will auto open visual studio upon seeing him. Any leads would be appreciated. 😊15 -
I have a huge problem.
I fell in love with a girl and I can't concentrate enough to code. I sit at my PC, open editor and start, but from time to time I find myself staring blindly into a screen realizing i lost some time thinking of her. Then I get back to work, but I start to write nonsense out of confusion. Today ive been trying to code from 10 am til 4 pm, but nothing. Ive literally done nothing today. Just lost time...25 -
!rant
My laptop feels complete again. I'm back up to 32gb RAM after being down to 8 for a few months...
Now i can have all the virtual machines open without worrying about maxing out my system... time to go break things while I learn what they do! 😄4 -
The story of Netscape and Internet Explorer really proves the irony of fate! And how life will come back to bite you.
Back in the 90's you had to pay for browsers like Netscape (it was called a navigator but same thing) but after Microsoft released IE for free with your windows copy in 2002 it crushed Netscape and nobody used it anymore (the graph below).
But! Netscape wouldn't give up and before the company died after it made legal accusations against Microsoft and Bill Gates and made them pay for that they did, but Netscape was too far gone and already were falling apart they decided to make a self detonation (I guess that's what they thought being in that tight corner) and they released the code as open source which would later get taken by Mozilla and be the code base for Firefox.
Now look at how much better Firefox is and how nobody uses the shitty IE!
Kind of reminds me of the scene from watchmen where Rorshack was in prison and said the best sentence in the movie "I'm not locked in here with you. You're locked in here WITH ME!"17 -
The Indian state of Kerala uses Linux(Edubuntu) in all the schools. This incident happened back in 2010. I was not that proficient in Linux but I liked it for some reasons.
So one day, one of my IT teachers was handed the responsibility to edit a video. Being the School Student IT Convenor, he asked for my help. I'm no Video Editor but this thing was so easy that Openshot was enough.
While I was at it, he said: "Why does the govt. want us to use such unprofessional stuff? If it was Windows we could do everything very easily. Who is ever gonna use Linux in a professional environment? The govt. is spoiling the children by urging them to use Linux, Free Software and Open Source."
I couldn't argue that day. But today I so wish I could go back and roast him!4 -
Holy moly..
Working on my MacBook and out of nowhere: *click* dead..
Try to restart it, fan spinning for a second, then: nothing.. recovery mode. Nothing..
FUCK!!
Doing research on my iPhone.. see Louis rossmann had a case like this in which one foot of the clock on the main board doesn’t have connection.
But I don’t have the right tools to open the MB..
I turn it around, shake it shake it shake it shake it baby like Taylor swift, knock on the back, knock on the keyboard and voila.. working again😪
Didn’t think that still works with modern technology..6 -
Don't cha just love it when you download your "native" desktop application to host a meeting, only to find out its actually a wrapper around a browser?
How did I find out? Well I innocently tried to drag and drop an image to share, only to have the browser open and render that file instead of uploading it, killing the application it was running behind it, closing the meeting for everyone on it ... and not even be able to access a back button to re-open the session.
viva la hybrid!2 -
Things you can enjoy when working in an office with other people:
- listening to everyone chew gum with their mouths open.
- being constantly interrupted by coworkers asking for help, even when wearing headphones.
- getting distracted by someone bursting out in laughter of some private joke.
- having to take a break when everyone else does, because everyone is so loud you just can't focus.
- being hit on the back of the neck by a nerf gun bullet, right when you're most focused.
Why would anyone ever want to work at home?9 -
> replaces HDD with SSD in weak-ass laptop, powers it on
> "wow, this is really fast, pretty cool"
> powers on ultrapowerful HDD based desktop pc
> AURGH WHY DOES IT TAKE MORE THAN 0.01 SECONDS TO OPEN THE FILE EXPLORER I CAN'T LIVE WITH THIS SHIT GO FUCK YOURSELF YOU USELESS PILE OF CRAP
> goes back to weak-ass laptop
> contentment
'tis true, once you experience the glory of SSDs you can't go back to HDD based systems.6 -
My first real "rant", okay...
So I decided today to hop back on the horse and open Android Studio for the first time in a couple months.
I decided I was going to make a random color generator. One of my favorite projects. Very excited.
Got all the layouts set up, and got a new color every tap with RGB and hex codes, too. Took more time to open Android Studio, really.
Excited with my speedy progress, I think "This'll be done in no time!". Text a friend and tell them what I'm up to. Shes very nice, wants the app. "As soon as I'm done". I expected that to be within the hour.
I want to be able to save the colors for future reference. Got the longClickListener set up just fine. Cute little toast pops up every time. Now I just need to save the color to a file.
Easy, just a semicolon-deliminated text file in my app's cache folder.
Three hours later, and my file still won't write any data. Friend has gone to sleep. Homework has gone undone. My hatred for Android is reborn.
Stay tuned, the adventure continues tomorrow...11 -
my laptop was outside in my back yard during the whole night
damn its cold
no problem ill just fucking open 30 chrome tabs and android studio, like always thats enough for overheat3 -
The year is 2218. Machines have taken over the world. A small pocket of resistance fights back against them. And in their darkest hour, Windows, which hasn’t been updated in over a century, still won’t tell their strategists what program is keeping the USB drive with their plans open. They don’t want to unplug the drive as that could damage the files.
While they’re trying to figure it out, the attack comes and catches them all unaware.
As a result, humanity is extinguished.
Don’t let this happen to you.5 -
Really fucking sick of people taking my coffee mugs on the drying rack and taking them back to their desk. It's not yours. It doesn't have our company logo or your company logo. It's obviously not yours so don't fucking touch it.
This is the second coffee mug of mine to go missing in 16 months. You work at a tech company buy your own fucking mug or open your mouth wide and catch your hot bean water you fuck.13 -
Racism is still a thing in Germany...
At 11 am, I parked my car in to the right parking lane. It didn't cross any line. A woman in her 50s had the door to my side open and still didn't decide to close it, when I was parking.
Anyways, I got ready to get out of the car. All of the sudden, she knocked on my door. I did open the window.
[Short break: S=She and M=Me]
*Dialogue starts here*
S: How dare you park here?! Over there *points to the next parking slots next to her car* is enough place for your car.
M: I am allowed to park here. Plus, I am not crossing your lane. Aside from that, your door was open. Close the door first (before you fucking yell at me, you bitch - I didn't say this tho.).
S *completely ignores what I just said and focuses on my first phrase*: Of course, you are allowed to park here. But you are also allowed to go back to Turkey! *goes back to her car*
M *completely shocked and thinks about what I have been doing wrong and how Turkey is even related to this parking situation*: FUCK OFF!
*notes her license plate*
*finally gets out of the car. locks it. walks slowly in front of her car, when she just wants to drive away from the parking slot just to annoy the shit out of her with a big ass grin in my face waving at her*36 -
I once worked Tech Support for a point of sale software package. There was really no internal help desk, so we got all of those questions as well.
One day our front receptionist that her computer is being really weird and she can't type - it keeps inserting 3s in the middle of what she is typing.
I take the short walk down the hall to her desk and see that, indeed, a never ending string of 3s is being input to her screen.
"I can't figure out what's wrong." she says.
Then I reach over and remove the edge of an open binder whose edge was resting on the 3 key and enter key on the num pad.
"That should fix it."
Walked back to my desk.1 -
Le Me: well it is the time to go back on that Android project and resume the work.
*Open Android Studio, open the project.
*Wait 10 minutes for build/index
*error: gradle outdated, that is ok, update it.
*error: some library needs update
*error: R not found
*error: internal IDE error.
*Clean Project: PC hangs, Fan go so fast..
Shit ! I even not touched the code !8 -
Microsoft are getting a lot of pats on the back today for open sourcing MS-DOS. It might have meant something before FreeDOS was so well established and mature, but now... really, who gives a shit? Even more significant, they already "open sourced" it before, just not hosted on GitHub.
Here's the thing. Going open source is like losing your virginity. You only get to do it once, you can't take it back, and you certainly can't claim to be doing it again just because you're using a different host.9 -
Why the fuck contributing to opensource is so much pain. They get back to me after 8 months of my open PR. Sir, I don't remember a fucking thing I wrote...5
-
It's been a year , I have been contributing to open source and using GitHub.......
There were some people who criticized me for doing open source, saying there's no future in that and u will end up doing nothing.
(But I never listened to them and ignored there words)
Few days back the same person asks me how to start contributing to open source and help him learn git.
U know what I did then??
I ignored again.2 -
It's 2018 and folks are still stuck "collaborating" on documents by sharing them back and forth over email.
MS Word Doc created in Office 2016 will not open in Office 365.
THIS IS WHY GOOGLE IS WINNING!10 -
Installed an SSH server on my desktop so I can use the shell from my laptop...while still sitting in front of my desktop. Keyboard is less than a foot beyond my reach because leaning back, but laptop is in reaching distance.
Still have that SSH server up for mainly the same reason. Decided to also open it to WAN so I can do shit while I'm not home too.4 -
I was working on my PC, picked up my phone to order food (hunger is killing me)
devRant app was already open
*used it for like 10min, puts it back
*Forgot to place order*
Picked it up again, writing this rant!!2 -
Should I Close-Source my project?
I have been working on a Desktop/hacking simulator game and up until now the project has been Open-Source. I'm at a point now where I haven't gone too far to turn back.
Last night I got to thinking about my game, and what I want to do in the future. The game will always remain Free, but I might sell it to another company later down the line, something I can't do if I stay Open. I want to makea good game. And I don't want to do it for money (because that has never worked out for me in the past) but I want to *be able* to make money if I wanted to. I mean, I have been told by several developers that my game will be "ground breaking/a worldwide phenomenon/a Minecraft competitor" while being Open is one of my main selling points, besides populatity, what do I have to gain? I said I don't want to develop for money (mainly because the pressure gets to me) but I'm so poor I'm almost literally starving. I make $3/mo from Patreon and survive from donation from relatives. I feel like I need this. But I also feel selfish. Information should be free, ya know?
Idk.. This started serious and turned into a ramble.. Guess that's what this app is all about.
Leave your opinions below.25 -
At a festival where I was with my GF from back then, I asked her whether it was OK if I drank some more, which she was fine with, but she didn't get the implication.
Later in the tent, when I was totally drunken, she turned me around and wanted some action. The sudden movement didn't go well, I was just able to open the tent, vomited out of the tent, and turned around to continue sleeping.6 -
A few months back, me and my friends built our own Web Dev firm. I'm the one who talk to clients, customers, etc. and these have been the most ridiculous messages I received from them:
1. I don't like it, but I don't know why?
2. I have an idea! Can we change the design?
3. We want something with more of a `wow` factor.
4. Can't you just copy their logo?
5. But we are also a startup. You must understand that we can't pay the full price.
6. So do you have the file open and ready to edit/
7. Can't you just copy and paste it in?
8. We don't have much of a budget but there are plenty of projects coming your way.
These are just a few of the huckleberryfuck our clients sent. I'm not sure if I can handle them anymore.5 -
Devrant feature: It would be cool that when you wanna write a comment, it doesn't open a new page, but a textarea appears at the bottom, so I can re-read the other comments and the rant without going back.19
-
Could you put a backdoor on the software so i can see what my employees are doing ? Don't worry I'll pay you more.
Yeahhhh buddy I'm out, give me my card back.
What the fuck im going back to my open source safespace.3 -
Round up kids.
I have a story to tell. The story of a war I've lost. Many battles were fought and many hours were wasted.
This is the story of wasp in a computer lab.
Today, the weather was good. So your old pal, Nomi, decided to open the windows. And as usual, that's where it all started.
So Nomi sat down and worked for a few hours. Tweaking two different neural nets, adding to its dimensions and concatenating the living shit out of the data they were supposed to process. After, she tried testing and testing and testing. It was early afternoon at this point and she was hungry. She went to close the windows and go for lunch.... When she realized, that she's not alone in the room. A big ass wasp was sitting on one of the curtains.
Now, Nomi doesn't have a good relationship with bugs and flying shit. Wait, no, she doesn't have a good relationship with moving things in general. So she panicked. She begged the wasp to leave. The wasp sat on the curtain and smirked at her. So after a while, she left the windows wide open, turned off the lights, put her hoodie on and went for lunch.
(btw, at this point my hoodie smells of sweat, fried onion, steak, cigarette and shisha. Don't ask. It was a long two weeks)
When she came back, the wasp was nowhere to be seen. So she assumed that the wasp got tired and left. But oh, how wrong she was.
After few hours, she heard something. She assumed it was just a fly. Actually, she hoped it was a fly and not the return of the wasp. But all her hopes were in vein.
She heard a buzz. And all of a sudden, an angry wasp flew in her direction. She dodged the attack and got under the table. But the wasp was not letting this go. Nomi jumped out of the room and left the door open. The wasp hid itself. She waited and waited but no sign of wasp. So she ran back in the room, and opened the window and ran back outside. She waited. The wasp occasionally would fly from one hideout to another. The wasp was making herself comfortable. At one point Nomi got angry and threw a shoe at the wasp, but the wasp caught the shoe and threw it back at her while maniacally laughing at her.
So she gave in. This was enough for the day. She ran back in, closed the window, turned off the computer, took her bag, turned off the light, and closed the door. All in less than 15 seconds. She came outside panicked and distressed, and now she's on her way home hoping that by tomorrow the wasp is gonna be dead.
The wasp and the robots are sitting alone in the lab tonight. I hope when the robots uprising happens, the robots can forgive me for abandoning them powerlessly with a wasp. 😟22 -
Back in my sysadmin days we had an IT zoo to look after. And I mean it... Linux side was allright, but unix.... Most unices were no longer supported. Some of their vendors' companies were already long gone.
There was a distant corner in our estate known to like 2 people only, both have left the company long ago. And one server in that corner went down. It took 2 days to find any info about the device. And connecting to it looked like:
1 ssh to a jumpbox #1
2 ssh to a jumpbox #2
3 ssh to a dmz jumpbox
4 ssh to an aix workload
5 fire up a vnc server
6 open up a vnc client on my workstation, connect to than vnc server [forgot to mention, all ssh connections had to forward a vnc port to my pc]
7 in vnc viewer, open up a terminal
8 ssh to hp-uxes' jumpbox
9 ssh to the problematic hp-ux
.....6 -
I bought Minecraft back in 2007 or 8. It was $20 and gave me access to Minecraft forever, all updates included.
Today Microsoft closed all the old mojang accounts and I no longer have access to Minecraft. I could have migrated to a Microsoft account, but it will be a cold day in hell if I ever open one of those.
Sounds like law suit material. Class action anyone?12 -
I don't get it, really...
A web agency in my city published an ad on a jobs listing website; they search a php programmer who knows about magento. On their website, in the "contact us" page, they say that they are looking for:
- a graphic designer
- junior php dev
- magento dev
I sent my cv; they call me back for an interview.
This morning i went there for the interview; when the interview ended the guy just said to me "well, we don't have any open position at this moment. We make interviews from time to time, just in case in the future we may need help".
Ok. Now 2 things come to my mind:
1- i need a job now; if 3 months from now you call me cause you REALLY need a php dev, i will probably (hopefully) already have another job
2- FFS i lost 2 hours for you: 50 minutes of traffic going, 20 minutes interview and another 50 minutes of traffic going back home...
Just why?5 -
Someone "advised" me today to start going to bed early because it improves my health. Well, it's been 3 hours with my eyes still open.
Screw it am going back to code.6 -
Old client texted me yesterday: the website and pos system you made does not work anymore... Why ?
I saw that their domain was moved to another host and texted back: "some has moved the domain so that's why."
Client: "how can this be fixed"
Me: "move the domain back"
Client: "but then the new system I bought cannot function".
Me: oh well, then you are in trouble, if the new company you hired to make you a new system and website had been using just a little brain power, this would not happen. Now you have to bring your new system up and working before you open your store...
I could have helped them by pointing a sub domain to the server, but he never ever treated me with respect, and never payed in time, and he did not tell me about this move before he initiated it.
Me: shuts down server and thingking: good luck working with those new "professionals"4 -
Junior dev requests for sudo access on a server instance for some package installation, gets it, figures out how to open the root shell - never goes back. They do everything on root.
Fast forward to production deployment time, their application won't run without elevated privileges. Sysadmin asks why does the application require elevated privileges. Dev answers, "Because I set it up with root" :facepalm:15 -
Open terminal.
Type "telnet towel.blinkenlights.nl"
Press enter. Sit back and enjoy.
Thank me later.11 -
Last meeting I suggested we started using unit test and perhaps TDD on our platforms.
My boss is open to it and everyone seems to like the idea...
Now I just discovered that our dumbass coworker is trying to say by my back that its a bad idea to double the code efforts and that he sees no point in it...
Well dumbass cock sucker who can't even fucking remember how to write `docker-compose up` without messing things up you can fuck your self because you are certainly gonna be fucked sideways untill the end of the year.4 -
Support elevates a ticket.
Ticket: customer is getting a weird error uploading photo.
Can’t recreate. Tell support to call them back. I’ll sit in on the call.
Watch the process. Noting extraordinary...
Hmm.
Me: can you get the customer to open the pic in photo viewer?
Support asks as much.
Support: uh, he says he gets a similar error opening this photo in the photo viewer.
Me: 🤦♂️ that is a corrupt file! -
Joined a new company / team to work on an iOS app that has 2 different backend environments "Dev" and "Prod". Also being referred to in iOS speak as "Debug" and "Release".
Been trying to get accounts on these backends (no sign up in app, its controlled via another process). Eventually get access to "Dev" for one of the regions, so I load up "Debug" and its not working.
This is odd, so I open the Android app and load "Dev" and it works? I then Notice Android has "Dev", "QA", "Staging" and "Prod" for every region where as iOS only has 2 of these.
So I go back to iOS and find the file for the settings and it has iOS Debug assigned a variable for the backend Dev ... which is actually pointing to QA. Because they use QA to Debug and not Dev.
... confused? join the club3 -
TL;TR
My mum just came to me asking me why the mouse is not working ...like I'm GOD of electronics :( (I'm just a simple dev) I simply though that the battery is dead because it's old. Soooooo.....
I showed her how to open it and how to change the battery. After 5 min she came back with a new battery and the same mouse asking me to fix it for her....
In my mind I literally snapped my brain was bleeding and exploding at the same time.
I just cringed a fake smile and changed the battery in front of her very slowly. I sure she won't remember how to do it next time.
At the end of the story I can't talk back or be angry to my parents I have to much respect for them. They though me everything from how to poop, speak, dress, eat and so on.
Be kind to your parents.5 -
This is something I'll never forget.
I'm a senior UI engineer. I was working at a digital agency at the time and got tasked with refactoring and improving an existing interface from a well known delivery company.
I open the code and what do I find? Indentation. But not in the normal sense. The indentation only went forward, randomly returning a bunch of tabs back in the middle of the file a few times, but never returning to its initial level after closing a tag or function, both on HTML and JS.
Let that sink in for a minute and try to imagine what it does to your editor with word wrapping (1 letter columns), and without (absurd horizontal scrolling).
Using Sublime at the time, ctrl+shift+P, reindent. Everything magically falls beautifully into place. Refactor the application, clean up the code, document it, package it and send it back (zip files as they didn't want to provide version control access, yay).
The next day, we get a very angry call from the client saying that their team is completely lost. I prove to the project manager that my code is up to scratch, running fine, no errors, tested, good performance. He returns to the client and proves that it's all correct (good PM with decent tech knowledge).
The client responds with "Yeah, the code is running, but our team uses tabs for version control and now we lost all versioning!".
Bear in mind this was in 2012, git was around for 7 years then, and SVN and Mercury much longer.
I then finally understood the randomness of the tabs. The code would go a bunch of tabs back when it went back to a previous version, everything above were additions or modifications that joined seamlessly with the previous version before, with no way to know when and so on.
I immediately told the PM that was absurd, he agreed, and told the client we wouldn't be reindenting everything back for them according to the original file.
All in all, it wasn't a bad experience due to a competent PM, but it left a bad taste in my mouth to know companies have teams that are that incompetent, and that no one thought to stop and say "hey, this may cause issues down the line".4 -
I've been using microsoft dev stack for as long as i remember. Since I picked up C#/.NET in 2002 I haven't looked back. I got spoiled by things like type safety, generics, LINQ and its functional twist on C#, await/async, and Visual Studio, the best IDE one could ask for.
Over the past few years though, I've seen the rise of many competing open source stacks that get many things right, e.g. command line tooling, package management, CI, CD, containerization, and Linux friendliness. In general many of those frameworks are more Mac friendly than Windows. Microsoft started sobering up to this fact and started open sourcing its frameworks and tools, and generally being more Mac/Linux friendly, but I think that, first, it's a bit too late, and second, it's not mature yet; not even comparable to what you get on VS + Windows.
More recently I switched jobs and I'm mainly using Mac, Python, and some Java. I've also used node in a couple of small projects. My feeling: even though I may be resisting change, I genuinely feel that C# is a better designed language than Java, and I feel that static type languages are far superior to dynamic ones, especially on large projects with large number of developers. I get that dynamic languages gives you a productivity boost, and they make you feel liberated, but most of the time I feel that this productivity is lost when you have to compensate for type safety with more unit tests that would not be necessary in a static type language, also you tend to get subtle bugs that are only manifested at runtime.
So I'm really torn: enjoy world class development platform and language, but sacrifice large ecosystem of open source tools and practices that get the devops culture; or be content with less polished frameworks/languages but much larger community that gets how apps should be built, deployed, monitored, etc.
Damn you Microsoft for coming late to the open source party.11 -
Kid brings me an ancient Chromebook with non-functioning "t" key.
I crack open the case and remove a bunch of screws trying to get to the keyboard.
No can do. This thing is built to basically self-destruct upon user tampering (Dammit, China!!!)
Put it all back together with the intent of trying to wipe it and recycle it.
The "t" key is suddenly working fine.3 -
1. Browse devRant mobile app
2. Open a rant
3. Switch to browser to check something quickly
4. Switch back to devRant after like 3 seconds
5. Previously opened rant is gone and I'm back at latest rants feed3 -
Loving rantBlock 🙂
I just re-enabled it to show a friend... I really do some of my best work at 2am 😂
FYI:
This collab is still (to the best of my knowledge) the most popular collab on devRant. I ranted a while back that it's open to anyone who wants to get involved to work on production version to publish to mozilla, google etc. Personally I would love to build the rant replacement functionality into a fork of uBlock but I simply don't have the time at the moment - so if your looking for a side project...
Collab LInk: https://devrant.com/collabs/...3 -
when you have a million applications open on your computer because you're in the middle of some massive change and you come back the next morning to find out that your machine has restarted during the night...😲6
-
I've been neglecting my 150 stars github library for the past month because I don't have time... Feel bad about it (9 open issues 1 nice pull request and one behind example library)2
-
The next motherfucking asshole, that says there is a shortage of trained IT personnel in Germany, will get their eyeballs ripped out and squished back into their mouth.
I've got my trade degree in mid August. since then I've been without a job. The first 2 months where, bevause my former employer took ages to create my work-certificate (document that shows that you actually worked there and what you did).
Since then, I applied to a multitude of companies and got denied for various reasons. My favorite was "seems unmotivated".
The number of open IT positions is directly correlated to the collective assholelishness and entitlement of HR/management.27 -
"Time to install Arch Linux!"
*8 hours later*
"Back to Open Suse!"
Repeat every 4-5 months.
Seriously, I would LOVE to get Arch running on my laptop, but everytime I try to something goes wrong, be it bootloader, audio, cooptimus drivers, undetected network card, window manager going crazy, etc etc etc... and I simply end giving up and reinstalling my backup.
Someday, Arch, someday...4 -
After investigation, I'm just refreshing my os and hoping I can reconfigure work applications. Feel bad, but help desk friends are getting me the software to install and are helping me out on a day off.
Wasn't the application like I thought. It was the useless update that won't install and therefore can't be rolled back but is still getting in the way of my work, therefore they can all daisy chain their dicks together in the sane manner little kids make daisy crowns, and then have a steamroller head towards them with faulty brakes (steamroller operator is innocent in this scenario, he jumps out safely).
I'm planning on calling Microsoft in the morning to tell them what I think of them at the moment. But I'm too angry to form words that don't sound petty and childish. I'm open to suggestions.2 -
Saturday. It's already an evening. Kid is asleep. Wife is doing her thing in another room. I'm on my own, I now have time do do whatever I want! So a personal project time it is!
Open up a lappy, wake up my Mint. Switch to a workspace with IntelliJ ide. There's some message popped up on a screen. With a red cross. Read the message -- your licence has expired.
Shit.
Open up chrome, go to jetbrains website, log in, purchase an all-in licence page, filling in the form, last check before confirm... Wait, that ain't right. That's my college email I no longer have access to! Phew, it's a good thing I checked before submitting!
Go to account settings, update my email address, go back to licence purchase form, fill it all in, last check, and...
Wait..
Email hasn't changed. What if they send something valuable to my mailbox upon lic purchase? I can't risk, it's 200€ after all...
Oh come on! Open a support ticket. But it's Saturday so I don't think I'll get a response until Monday :(
and there goes ruined a perfect evening for some coding :(
shit...5 -
React is a nice js framework, but I constantly find myself with 50 different files open because every component and related css file is spread across the world. I get why our frontend guy built it with so many modular components, but it makes me feel like back in the day when libraries were a thing and you had to flip through those giant Dewey decimal system drawers of cards to pull out the one little card you want to then hunt for that one little book you wanted to find that one little line from4
-
Now that I am coding for money, the motivation to learn and build new things is gone. It has become all about money for me now. I get tired after coding all day and I can’t open my personal laptop to learn new things and do some more.. well.. coding.
Will I ever get that motivation back? Because I have some good ideas in my mind. Just can’t seem to start working on those ideas.8 -
Recent boot camp grad here with a solid portfolio...holy crap...this industry is so illogical...got a call from a recruiter whose job needs 3 years experience. I demonstrated I know every single one of the requirements, have implemented them, know pros and cons, etc. She says OK I'll run it by my manager and see because we can't fill the spot and it requires 3 years but you meet all the qualifications. I get an email the next day, and she says sorry, we actually need 5 years...fucking face palm...I'll apply again in 5 years because that job will still be open. Really sucks that the only thing holding me back from landing a job is experience, not knowledge. No employer wants to touch me with a 10 foot pole...how long will it take be to find a job...jesus christ.12
-
Anyone else experienced that the not responding apps come back to life when you're about to open Task Manager or you've opened it already? I suspect they get scared of their god.1
-
spent 8 months building and customizing a vtiger database for work. tons of fun got it to a point where I have saved a ton of time for all the people that use the program. boss wants to have reports out of it each morning, so I showed him how to run reports and adjust entries. he didn't like the formatting of the report. so I set up the report to export to excel and took another 2 hours building a macro that formats the way he likes and prints the report for him. he used to take a month filling out paper work to get a report, now all he has to do is open a favorite on his web browser, make 3 clicks Then open an excel and type ctrl+r and it's done. he tells me it seems too complicated and is considering going back to the paper method...so frustrating.2
-
I just want to share my very first companion. Haha... This is btw my laptop way back 2011, used it to store highschool memories and silly stuff, if you know what I mean. This is the laptop that I first used the labrynth of directories such as A folder contains A to z Folder and again inside one of those contains A to z again lowered and upper. This is also my partner in coding C++ back in the days, I usually write code in paper and when back to school I used our lab's computer. Ohh and I also have my anime addiction started on this too! One time I discovered the side VGA and connected it to our big LCD screen but by the time I plugged it in, it produce explosive sounds, and my grandpa said that that lcd tv is only for 110v not for 220v. I learned the importance of voltages that day. I just went back and open it to backup my highschool memories and stuff to my external hdd. Ahhhhh memories.3
-
#fuckapple for holding back the open-web. Most folk don't know that Chrome on iOS is just Safari with a skin; neither Google or Apple want you to know that.
If you hate web-apps on iOS, that is Apple's intentional doing. Apple cannot allow a bug-free and modern browser to run on their iOS devices, else they lose their 30% tax + dev fees cut. There are literally so many crippling bugs in iOS Safari that it HAS to be intentional.
There are email exchanges between Phil Shaffer and Steve Jobs from years past, where Phil didn't believe Apple could continue to gouge users 30%. He argued the open-web would make native apps largely redundant, and so to stay competitive, they'd need to drop the store fees to something reasonable. I suppose Steve Jobs saw a different solution -- just impede browser development.
As someone who develops free and open-source apps, I believe I am doing the world a favour by not supporting a native iOS app. When users complain about missing features in the web-app version, I tell them to take it up with Apple or buy an Android. Guess what? They sometimes actually do just that.
Join me if you have the balls. Tell Apple to FUCK OFF the only way they understand -- threaten their bottom line. At the very least, you'll never need to touch XCode again if you do. If time is money, that alone will make you wealthy.8 -
Do you ever wonder why EVEN Microsoft uses web technologies to build apps for Windows?
Because the StAte oF tHe aRt piece of shit WINUI 3 (aka Project Reunion aka Windows App SDK aka Microsoft 12th app framework in this decade) can't handle a basic save/open dialog.
An issue has been opened 2 fucking years ago and still no fix. (Other than write 250 lines of c# and c++ to get a fucking dialog)
Fuck this I'm going back to Electron.5 -
Got a few Jira tickets reassigned to me because the dev who was supposed to work on them got stuck on another project. It's fine, that happens.
I open the tickets. No descriptions for all of them. No screenshots for those reported as bugs, nor any replication steps. No attached test cases or, well, ANY useful information.
I talk to our BA, he says that all information I need are in OTHER tickets on ANOTHER BOARD that business manages but I DON'T HAVE ACCESS TO. Honestly, these shitfucks could've just done simple copy/paste. But nooooo...
So I reassign all the tickets back to their original reporters (business testers) with comments requesting more information.
It's been a week. Now I have no idea what to put in my time sheet.1 -
Bro every time this guy wants to create a PR, rather than branching off another branch and raising a PR to get it merged back in, this dude creates a fork and then makes a PR to merge the fork back in.
Holy. Fuck. Please don’t do this. It makes checking out your “branch” a massive pain in the ass. Plus, it’s totally unnecessary, and I can’t even check it out to begin with because your forked repo is fucking private you stooge. If we were in completely different orgs or doing open source I’d understand a fork. Not if you’re sitting right fucking next to me!!!!!11113 -
Uggg..... I'm trying to encode a binary file in Python which may be an image or may be an executable, and then decode it back into a file (I plan on editing it in the middle, but baby steps for now..) but nothing is working!!
My plan is to:
Open binary file.
Decode as base64, or something else that could easily handle binary.
Convert byte data to string (for editory perpousos - I won't be editing bytes, I'll be doing custom encoding but that's irrelevant for this test)
Convert back to a byte string/array (with .encode(), probably)
Write to file.
I do this, yet the output has been altered... Though I haven't touched anything..
It's so enfuriating.. x.x18 -
If you're the alone maintaining them, you learn a lot.... But they increase responsibilities.
I started with 1 open source project 2.5 years back. Today I'm maintaining more than 20 OS projects. And believe me it's really difficult to support them, maintain them5 -
Send an open-solicitation to a company for a medior PHP back-end developer.
Got rejected because "I do web development"...
Bitch, I'm writing an entire CMS in PHP, write entire DNS servers in PHP, write Discord bots in PHP, wrote an entire gameserver in PHP and you're gonna whine to me that "I do web development" because I also know front-end stuff?5 -
Some idiots ripped off our work and code that was open sourced and wrote a paper on it and got it published from some cheap publisher. Even for me to some benefit of doubt or consider that probably they worked on advancing our research….they didn’t even give us any credits!
Heights of shamelessness!
FYI, we already had an IEEE paper published!
I don’t mind if you guys have any suggestions on how I can get back at them. I don’t think a rant is going to calm me down for what they have done.7 -
Client: Each invoice should be it's entity. It should only report it's own open amount. Any other open amounts remain on the other invoices.
Me: No problem. ::Sets invoices to only report own open amount::
PM: Hey, the invoices in UAT are not displaying the sum of all open bills.
Me: I know. The client wants each invoice to only report the open amount on that specific invoice.
PM: That can't be right, change it back before we give the client access to the UAT environment.
Me: No problem. ::reverts invoice changes::
Client: We are failing the invoices. The invoices should not be giving total open amounts for the account. Each invoice should only report the open amount for that invoice. We told the development about this...
PM: I see. I'll make sure he understands your request.
Me: ... ::reverts the revert::
PM: Hey, the invoices in UAT aren't giving a total of the open-
Me: OMFG. I just want this task closed!
Client: After the invoice work is done, we need to talk about past due amounts and how they are reported to customers.
PM: Sure thing. It is logical to give a total of a past due amount to the customer...
Me: ::Starts updating resume:: -
Watched a TED Talk about this cool site that wants to bring open education to all.
Forgot about it.
Remembered i
the video a week later, checked it out.
Front page saw a course for Python for beginners.
Watched the first video.
Got hooked.
Never turned back.
Thanks Coursera :)
After that I relied more on books as the knowledge is layed out in a more concrete fashion and are probably nore revised. So better content, more accurate information, more advanced and in depth knowledge. -
My former coworker had to mail their work equipment back to me..
6 boxes later..
Open up the first box. A mouse wrapped in about 4ft of heavy duty bubble wrap.. a keyboard box double layered in or.. and my favorite, a restore cd literally wrapped 4 times in bubble wrap. Why?
I'm scared to open the other 5 boxes8 -
Fucking Asus won't even sell me a battery for my laptop because it would require me to open the back plate of the device. I have to take it to a service centre and pay them to install it!13
-
I thought I'd opened every shitty type of Chinese-grade electronics by now. Glued in shit, ultrasonically welded shit, potted shit. And occasionally the now very rare piece of electronics that has actual screws.
Until now. Remington, apparently yet another company filled with certified enganeers. My razor is from them, and I wanted to open it up to see why the lithium cell inside was failing, and to replace it with a bigger one. 2 screws in the back of the unit, Phillips head. But holy fuck, those things sat in there more tightly than the glory hole of the Asian girl that probably assembled this thing. Externalizing our own features in our craft? Check!
Pretty hard to remove them but that's fine. But the unit didn't open up, and there seems to be no screws left. I guess that they leveled up their level of certified enganeering and actually used both screws and ultrasonic welding. Because why wouldn't you, right?!
Motherfuckers.5 -
Issue:
Facebook is now meta. We now need a new acronym to replace FAANG.
Proposed solution:
Let’s remove Netflix. There are a dozen other streaming services in the mix, they’re not innovating over competition, they’re also worth the least in faang etc.
Bring back Microsoft to the acronym. Controversial, of course but it makes sense as the ms we see today bears little resemblance to what it was 15 years ago. With ms + meta in the acronym we therefore name is GAMMA
Open to other alternatives, so leave a comment if you have one.27 -
Haven't used dR for long so Idk how many people have already ranted about this...but here goes nothing.
ANDROID 10 NAVIGATIONS
Fucking irritating piece of shit !!!
Ughhh!
I can get understand the swipey swipe for back etc. But the "swipe up + hold " for recent apps just makes me cringe !!!!!
Ok, Some how you manage to open the recent apps by precisely fingering your phone.
You gotta go back to home screen from recents ??
Open a recent app then swipe up for home.
Two fucking gestures to go back to home screen !
Or click the close all apps button for home screen.
This is non sense.
Pls enlighten me if I am missing something.
I want the two button navigation back 😭13 -
This was about 3 years ago. I’m on vacation and just getting off the plane, when my boss calls me on his cellphone. Apparently the crontab on our main file upload server had gotten nuked, and he was asking if there were any backups.
A word about this server. I work with video, so this thing is doing about a few gigabits of traffic incoming at any moment. The cron jobs are necessary to move and organize these massive files into a sane scheme for processing. Hundreds of drop folders receiving thousands of files resulting in terabytes of data every single day. Our storage vendor tells us we have the third largest deployment they know about.
No cron jobs mean all of this content is just sitting around piling up. I tell him sorry, try contacting $otherAdmin since he’s more familiar with that system.
A few days later, after the vacation, I come back in. $boss and $otherAdmin have reconstructed the crontab from scratch after an all nighter.
I ask how it got deleted.
$boss was training some people how to set up new customers on this file server, and he told the trainees to open the crontab in read-only mode. One of them ran:
crontab -r
Yes, we back up our crontabs now.3 -
Why I sometimes hate linux:
Found old computer with freya os.. I usually work on Windows, so I thought lets try to work on linux for a change..
First things first: sudo apt-get update / upgrade and while it is doing all the updates lets get something to drink..
Came back, logged inn and mouse is gone.. after some googling and searching on my mobile i found out that alt+ctrl+f1 and then alt+ctrl+f7 fixes problem..
Mouse now is back but upgrade failed half way though because no network.. wifi stopped working.. something wrong with drivers.. so to continue upgrade of OS i need a cable now.. (restart didn't work)
Two hours later I managed to update everything, wifi drivers are working and I managed to post this.. But it's too late to do anything, so I will probably put this away again for couple months and will go through same shit next time I open it.5 -
OK, I love Linux. But I hate the whole "sacrifice-functionality-so-it-can-be-completely-free-and-open-source" thing.
I tried to install Linux a while back on my old laptop, and getting Wi-Fi to work was a nightmare. Apparently they didn't have the right driver for my Wi-Fi card, because it wasn't "free" enough for them. ugh. Most people prefer for their computer to WORK than for every single piece of code to be open source. Who modifies their Wi-Fi driver and redistributes it?
Ugh. Linux is cool, but not this part.21 -
This was a comment I made on another ranter's post.
* Tailor your resume (and cover letter if needed) according to the job. No generic resume.
* Research about the company and make sure you have the same interests as the company. Clearly let them know why they should hire you. One question you can expect is: Why should we hire you?
* Show them that you're passionate about the job.
* Be curious. Ask questions. That's how they'll know you're interested.
* Be open to opportunities. Let's say you're applying for Full Stack developer role. Be open to take up Front End or Back End developer role. You don't have to accept everything but at least roles tangent to your job (provided they match your interest).
* Be flexible but focused.
* You don't have to know every listed requirement but make sure to know the majority.
* Don't lie. "Fake it till you make it" doesn't work with dev roles.
* Be confident in telling them "you don't know" if you don't know. Also make sure to tell you're willing to learn that.4 -
Oh my God I'm a failure. Been working on this booking system backend for two weeks, refactored some code, and now it doesn't work at all.
I've gone back through the entire thing, and I can't find the problem.
Open up indeed, start browsing for low-skill jobs. Maybe the carnies will have me back!
*Re-reads error message, adds missing underscore to function call.1 -
My very first wow, was back in 2011 as a freshman at university, algorithm classes. Our first language was Pascal, (because it was easy to learn and get to the idea of programming.) so, lecturer wrote Hello World! and that moment was the best part, when I realized that was called a program. After all these years I still remember this output. ❤️ awesome.
After this, its injected in my veins and soul. Even when I come home drunk or coming from the friends, I open my macbook and trying to write some cool , nerdy staff.
Its my life, my passion, my hobby. I dropped everything for this. ^^
Long story short, every time I feel amazing when I do something new and interesting. -
Started a new job today.
They gave me a Mac.
Why in actual fuck is there no shortcut for the terminal? Took me half a day to get an iterm hotkey working only to find out it only works if you have a terminal open already.
Stupid apple. I want my mod+enter back.8 -
New way of storing passwords "securely":
1. Open word and write your passwords in plain text
2. Save that word document and open it in notepad
3. Delete a random character but remember which one and in which position & save
Now the document won't be accessible with word and to fix it you have to put back the character you deleted.10 -
Recruiter calls to my open office job, asks for me.
Coworker: hey Such N. Such is on the phone for you.
Me: idk who he is, tell him to leave a message.
Coworker: ok. He says to please call him back about an amazing dev position @ XYZ.
Savage2 -
Tomorrow is my first day back after the holidays and I am so scared to open my inbox in the morning...2
-
Silly and stupid me.
Woke up.
Check phone. Check devRant.
Saw Trogus's filter update post.
Happy and left a comment.
Went to playstore and update.
Open devRant and use the feature.
Tried to filter only Rants and Questions type.
Happy and went back to sleep again bcz Saturday.
Continue the rest of day with other stuffs.
Use devRant again.
"Huh why the heck is the first post about some random quote?"
"Why the hell is second post meme"
"Why...why...why"
Check filter feature again.
Facepalm.
Silly me and stupid my eyes and useless my brain is not worthy for good and clean UIUX.4 -
Literally any of them. I've got several open projects.
My personal website- started it, got about half the front end done, no longer liked it, so I scrapped it. Take 2: got about half the front end done again, and again, didn't like it. So I just stopped working on it.
A website for a local business. I was just screwing around to test my skills, and got the entire front end almost exactly how I wanted it, and then just stopped. (I got busy and forgot about it, tbh.)
A fan page for a sports team. I was going to try and test my skills to make a blog-like website, got a large chunk of the front end down, and a bit of back end done. But it took a back seat to my personal site, and is just collecting dust.
I have procrastination issues. -
This day was awful. I just want to disappear. I want to stop existing, and come back in a few days. I had a day of pure depression and insecurity.
Don't bother replying or upvoting, that's just me writing this in the open for no reason.31 -
I work on a warehouse dev team. One day this past year, I was trying to deploy a new build to a QA server. Earlier that day I had been looking at the logs on the production server and had left the ssh session open. I had been working for less than a year out of college at this point and shouldn't have had access to deploy to the production server.
Long story short I deployed my QA build to the production server and saw there were problems connection to our production database. Then my heart dropped in my chest as I realized I had just brought down our production server.
I managed to get the server back up by rolling back in about 5 minutes and no one ever knew except some people on my team.
I felt horrible for the longest time. Later in the year another guy that joined my team that has about 20 years of experience under his belt did the exact same thing, but needed help rolling it back. Needless to say, that made me feel a lot better. 😂
Definitely the worst moment of my year.3 -
I was asked to check something today that was handed over on a USB stick. "Could you check that the file structure is correct". Of course I said. Then I prepared my camera, changed the insides of the stick to my rubber ducky, wrote a little script and uploaded it. Oh yea and corrected the structure.
The face of the colleague was priceless when I brought back the stick and he sticked it right into his computer.
The script was roughly:
- open browser
- open history
- search "porn"
- select second row
- enter
=D office pranks <32 -
Today, I say farewell to a piece of software that has shared my professional uprising as a dev, today I let go off an old friend, today i uninstall chrome, after nearly 12 years of dedication, hard work and pain staking performance issues from time to time, you went from the child star that fixed what was wrong with browsers back in 2008, and became the abusive man child that crashes my system when I open you now, so enough with your bullshit.
Today I transfer my things to Edge(chromium) and say farewell old friend, there's only so many BSOD's you can cause just by launching a new tab without hardware acceleration before I can not stand the sight of you anymore.
I wish you a good and stable life, but your creators obviously couldn't give a fuck anymore about being the "light weight and fast" browser you once were.rant all good things come to an end chrome 11 years of freindship trading you in for a new model edge bye bye9 -
I heard good things about Edge recently and thought that I should give it a try for a few days.
I’ve opened the same pdf file in multiple Edge windows and and tabs, each scrolled to a different page.
#1
The middle-mouse button scrolling is broken on half of the windows and tabs. You press the button, you see the scroll mouse curser. But it doesn’t scroll.
#2
Scrolling horizontally to an area which wasn’t visible before, the content there is extremely blurry. Scrolling vertically to different pages doesn’t fix it. Is it the pdf? No. It’s just Edge. Zoom in and out again and the blurriness is fixed for now. Until it comes back later on a random page.
#3
Duplicate another tab and suddenly it crashes all of the tabs and windows of Edge. Now I need to open them all again and scroll to the positions that they were before…
If you think that it was just a one time issue, you are wrong. All of them happened multiple times and after Windows reboots.
I’m back to Firefox again.4 -
Neat: MongoDB. Fairly easy to use, intuitive-ish JSON API. Thinking about using it on a project. Excitement.
Neater: Data validation. You can have it drop writes that don't match a schema. Excitement intensifies.
Braindead: It absolutely will not tell you exactly *why* the write doesn't meet the schema, leaving you to figure that out on your own, smart guy. Mongo smugly crosses its arms and tells you to go back and do it right without actually telling you what the problem is.
Fucking braindead: This has been an open feature request since year of our lord two-thousand-and-fucking-fifteen. https://jira.mongodb.org/browse/...7 -
I reset my mobile (Wileyfox Pro Windows 10) today and I had to open my old Lumia 535 to get a code for an app. The moment I turned it on the sensation of meeting a friend from old came back to me. I didn't realise I would be missing my old device.
It's kind of sad that Microsoft decided to pull the plug once again on their mobile platform. I liked the minimalism they brought to the interface and the integration they were trying to add between different devices.
All is gone now and I am left to wonder with the possibilities that would have brought.2 -
VsCode.
I have been on a journey with editors, all the way back to using edit.exe in Windows 95, to notepad, MS FrontPage, Adobe Dreamweaver, PHPDesigner, vim, nano, then out to Eclipse, Atom, Brackets, notepad++, back to Atom, then VsCode.
And by far, vsCode has given me the most productivity and customisation of them all to not care about what project I open, what language it's written in, or what frameworks are working behind it. I can switch with workspaces and everything is setup to go, yes it's a pain in the ass to setup, but it's a ducking dream to just open and jump in.
Now being able to use VsCode for Salesforce has dropped any requirement for me to keep eclipse around.rant wk206 solves my problems productivity++ multiple everything. multiple languages vscode multiple git hosts1 -
If you go back to Win 7 from Win 10, you realise that things open faster than you can even blink. Case being that you use an ssd ofcourse. Oh and lets not even talk about a linux distro like Linux Puppy, running straight from the memory! Hahah
Just remembered this and miss how lightning fast it felt!6 -
* You can barely keep your eyes open
* Reading rants becomes impossible
* You decide to go to sleep
Brain uses overload
* You mind is flooded with creativity
* You don't feel tired anymore
* Your phone is suddenly back in your hand
"Brain, why did you so that?"
Brain: "Because fuck you I guess. I wanna read more rants!"1 -
After this pandemic I cannot return to open plan offices. I learnt so much about aerosols, breath, air circulation and germs... I cannot go back... just the thought of it... disgusting5
-
Few months back, I reported a vulnerability in an open source project due to the fake alarm from Github without understanding it's consequences. The author of that project immediately locked, and closed the issue and deleted the detail.
Though he was annoyed with my this act but he taught me a good lesson of responsibility.
https://en.wikipedia.org/wiki/...3 -
So friend of mine gave me a laptop because she is used to Ubuntu and wanted me to install it on her Windows 10 laptop. She also said to copy files from folder to external hard drive.
I said, sure!
So I went back home, copied all the files to my external HDD, everything copied successfully. I formated the laptop, installed the Ubuntu and set it up.
Time to move the files. I hooked up the HDD, I click on the folder... It's blank...
Okay, so I thought thats maybe Ubuntu's fault. I hooked the HDD to my brother's Windows machine, I open the folder...
"File or folder is corrupted"
Well fuck my life. 8 hours have passed since I started the file restoration tool on my computer. It says it's 16 hours to go. Luckily it restored 214 files already, so there's a hope8 -
My biggest fear about publishing open source code is people looking at it and having the same reaction a have when I get back at my old code.2
-
I want to write something in PHP.
Yes, coming from me, it sounds like stockholm syndrome, but for me PHP is reminiscent of simpler times.
I want to get a server right where I bought the domain, with CPanel, log in with FTP and ~~push~~ (excuse me, _send_) index.php and other files there. I want to open phpmyadmin and throw some stupid fields together that won't work at scale, but "scale" will never happen.
I want to design websites without normalize.css, without any kind of javascript but some silly UI stuff, I want to send emails with sendmail and not sendgrid. I want my gradient buttons back.
Symphony and Laravel can kiss my ass.9 -
[Half question / half rant]
Would you rather work with a laid-back, humorous colleague who produces shit code and won’t understand advice for improvement?
Or would you rather work with someone who’s more serious, even slightly boring, but who takes quality seriously and is open to advice?
Yes I’ve worked with both types. Hands down I prefer working with the latter. With the first dude I’ll have good conversations and a good laugh at his puns and jokes. But at the end of the day I’m pulling my hair trying to make sense of his code and spending a shitload of time reviewing his PRs just to make sure he’s not fucking things up even more.4 -
- Created an account on devRant. Need 10 +1s to create an avatar.
- Got >10 +1s for the 1st rant. Yay!
- Spent ~30 minutes building a custom avatar. Not satisfied.
- Went back to select one of the pre-made avatars.
- Realized pre-made avatars list gets updated everytime you open.
- Closed & opened the profile page for 10 times. Still couldn't stick with an avatar.
- Back to avatarless. 😎😎3 -
@dfox in case you havent already discovered it i have found a bug with notifications in the iOS app.
Steps to reproduce:
1. open notifications
2. tap one of them as many times as you can really fast
3. It generates a new view controller for every time you tapped it.
obviously having to tap furiously is a bit obnoxious but i originally noticed it when the app was running slow and i tapped the notification a second time. It created 2 new view controllers instead of one so i had to actually go back twice to get back to the notifications screen.6 -
OPEN SOURCE CONTRIBUTION
Original post link:
https://linkedin.com/feed/update/...
Start your open source journey.
To Push your personal project to GITHUB.
1. git init
2. git remote add origin [link]
3. git add .
4. git commit -m "commit message"
5. git push origin master
To contribute to someone else project use the following steps:
1. Fork the repo.
2. Clone the project in your local directory using git clone [link]
3. After clone, create a new branch. git branch [branch name]
4. Checkout to new branch created using: git checkout [new branch name]
5. Make changes in Project then 'git add' and 'commit'
6. Push back the changes using git push origin [newbranch name]
7. Open Github web view and click the pull request button and you are done.
Follow Up Post: https://lnkd.in/fEMbTPC
GitHub Link of GIT-CHEATSHEET: https://lnkd.in/fhy4hmu
HD VIDEO: https://lnkd.in/fmq8GTd5 -
Really pissed at how Amazon is just assing off large chunks of money by offering managed services that use open source projects. Have nothing against Amazon but isn't open source supposed to be left open source, they should atleast setup a ratio of giving back to the community which developed the project, that's not a lot to ask for and to give!14
-
🐙/* Friendly reminder */ 🐙
Don't forget about Hacktoberfest, a great way of giving back to the open source community 👨👩👧👦. And remember, if you create at least 4 pull request you'll get a t-shirt! 👕👚4 -
Anyone here use atom? I tried switching to it from sublime, gave it a solid 2 weeks but had to give up on it. Just painfully slow, regularly taking 5-10 seconds to open a work project and let me start working on it and would continue to be slow whilst working.
Back to sublime now, so much better...21 -
Could someone finally make remote controlled bed that transform to armchair and can ride around the house so I don’t have to get up to grab a beer or open the door....
I want to ride to fridge and get back with some beef jerky without using my muscles.
Damn technology is always aiming for stuff that nobody needs.9 -
Context: Madre recently got a new laptop to replace her old HP, but since she doesn't know much about computers, I picked it out for her. I went a little overboard on the specs because I new it was a "family laptop" and I would end up using it more than she would.
Mum: *yelps after typing on computer*
Me: "What's wrong"
Mum: "This computer is too fast!"
Me: 😐
Me: ... "What?"
Mum: "It loads things too fast"
Me: "What do you mean?"
Mum: "When I click on the apps they open almost immediately"
Me: "That's a good thing"
Mum: "No it's not, it startled me!"
Me: ...
Me: ...
Me: ...
*goes back to reading book*1 -
Going back home for the holidays means becoming tech support for pretty much the whole family, unluckly.
As soon as I enter my grandparent's home, my grandpa says "Could you print some emails?". I open his laptop, and I start sweating as soon as I see the Windows XP logo popping up. He (obviously) doesn't remember his password, and the only way to access his (mostly defunct) web mail service is Outlook 2003. For some reason, the web mail provider's POP3 server dies, and i spend half an hour trying to explain it. I ended up leaving with him saying "Why are you even going to a computer engineering university."
Ah, family.1 -
Windows 10 Rant:
Windows 10 has so many frustrating issues. Most recent being when my computer, if the PC goes into sleep mode, or sits unused for 40 ish minute period of time (screen still on), when I return; awake the computer from sleep or sit back after being away, the WiFi stops working. Turning WiFi on and off again doesn't fix it, only way is to restart the device, which is damn annoying if you have multiple windows, chrome tabs, or programs running. Having to open and set everything back up is a complete pain.
I must point out, this issue only started happening when my device (auto) updated itself to the Anniversary build of W10.
Thanks Microsoft.2 -
I'm still wet behind the ears as developers go, and about a month ago I cobbled together a webservice. After many bug fixes I somehow got it working as intended, held together by tape and shoestring and creaking all the while.
This week, one of the consumers of the service wanted me to open it back up to change the name of the request .xsd. no functionality changes, just a name change.
I protested, worried my service would fall apart if I breathed on it. But he insisted so I made the change.
I just tested it and... it's working as intended.
But I still want to be mad about this!! -
once upon a time I went on vacation.
It was for 5 days and I went to Leh-Ladakh with my family. (Me, My big bro and my parents.)
It's a beautiful and cold place. Snow and High Mountain and no phone call from anyone.
It was supposed to be no call. But on the 3 days, I got a call from my junior and he said to me that server is not working and it's giving 404 error.
So I told him to go to Cpanel (It was client's server). After 1 hour I got a call back from him and he was not able to fix it.
So I had to open the Cpanel in my Galaxy Note 8, Open file manager, go through all the files and logs and fix it code in 2 or 3 files.
It took 4 hours to fix the problem. But that day I understood the value of my Note 8 and its big screen. Thank you, Samsung.
Note: The lake in the photo is Pangong Lake/5 -
I just had a nightmare I spilled my gin inside my computer. Might be putting that back under my desk... And not leaving drinks on my case with an open top...4
-
I started my career 7 years back (at the same company I am currently working) as an Asp.net developer. My company used to work in Microsoft domains back then. 5 years back one of our directors decided to dig into the open-source technologies and move away from Microsoft. And I was the first employee who was assigned to learn python. I thought about switching the company so that my 2 years of asp.net experience doesn't go waste. But I didn't as I started liking python. It was easy, powerful, clean, and same code ran on every fucking platform. And I was introduced to open-source.
Don't know best or worst, but this decision definitely changed my view about software development. I understood that money is not everything, passion is also important. The open-source community runs on passion and dedication. And I love the way it works. The bottom line is, I am happy. And python is beautiful. -
So let's talk about CNAs, Captive Network Assistants, these downsized browser that open on Smartphones when you try to login to a free wifi which requires you to buy sometging or accept some terms.
I fucking hate them. I'm a web dev which has to deal with these dumbfucks.
Back in the time, there was this dumbfuck who had the idea to capture http requests on network level and response with a redirect to his own landing page. Fuck this guy. Then some dudes had the idea of the CNA as a privacy security feature. A good idea. But also this guys: "hey, let's make them a huge pain to develop for".Fuck them, too. But then came the companies saying: "hey make us a huge SPA with all features we can think of for this fucktard of a browser."
I hate fucking CNAs2 -
At work one morning, I was asked in chat for a way to edit an xml file on a Mac. They couldn't open it due to permissions. I told them to open Terminal and run sudo vi /path/to/file.xml. Never got a message back about it, so I assumed everything was OK. Later that afternoon, I received another question: "I'm in, I've made the changes, now what? How do I get out?" It wasn't funny until I realized how many memes existed for this. I'd imagined they'd quickly opened and edited it and spent hours unable to exit it; though, realistically, it probably wasn't attempted until the afternoon. Truthfully, I was new to it, too, and have no idea why I suggested vi over something else.
-
Currents is back! Take DigitalOcean's survey on Open Source and get free Sammy stickers: http://do.co/currents-survey2
-
Hi guys, I got some questions for you:
I'm a 17 years old guy from south Italy with 5 years of programming experience, mainly with Java and Kotlin. Since finding a well paid job here is soooo hard (especially when it comes to IT), I will surely go to another country (England, Sweden, Denmark and Norway in my list) once I get my scientific high school diploma. Here are the questions:
1) I have very high skills on JavaFX, both front-end and back-end. Is JavaFX commonly used in companies? Or should I move to other technologies like Android?
2) Will my diploma (plus a good amount of open source projects) be enough to find a job?
3) What certified English level is commonly required in these countries?5 -
Only 25 days left to get my Fanatic gold badge in stackoverflow and my browser decides to open up the new window instead of the old one with all my pinned tabs in it... So I forget to log into stack overflow for a day resulting in me going back to 99 days of everyday visiting the site until I get my Fanatic badge... I feel so fucking depressed FML4
-
Coolest project I ever worked on was an anonymous ranting website called NightOwl. It was loginless, yet had sessions. you could open the website and start posting stuff, follow people, close the website, shutdown the laptop for a year and then open the website again and still get everyrbing back.
-
Usual python code problems coming from someone who has been coding in Javascript and PHP (<--no pitchforks please). It's been months already but old habits still keep on coming back
- adding a semi-colon
- mixing spaces with tabs
- using a lowercase boolean
- adding an open brace when declaring a function
- forgetting the colon ( ;'s brother) -
An open office wouldn't be so bad if the same 3 people would actually sit the fuck down once in a while and do some actual work. Distracting as hell. It's gotten so bad that I've started writing logs of how many times they get up during the day.
// the most egregious offender
// down: 9:00
// up: 9:05
// down: 9:15
// up: 9:20
// down: 9:23
// up: 9:32
// down: 9:45
// up: 9:58
// down: 10:05
// this pattern continues the entire day
And what are they doing during these exoduses?
- Answering their personal cell phone from stay at home spouses
- Throwing trash away even though they have trash bins right NEXT to their desks.
- Pacing back and forth
- Checking the thermostat
- Checking the contents of the fridge over and over
- Being an absolute asshole!10 -
This is actually a question about the devRant app.
I’ve noticed this a few times. When I click a rant repeatedly (say x times), from the front page or from the notifications pane, multiple layers of that rant open up. And I have to hit the back button x amount of times to go back to where I initially was (again, front page or notification pane).
Now, I understand an app capturing multiple user inputs on the same object but shouldn’t it also account for this by only considering those taps as one input, especially if the object is lagging and hadn’t been loaded? Why is devRant implemented this way?
I would consider it undesirable to have Gmail open the same email in multiple layers when you click the same email repeatedly. So, is devRant’s a feature or a bug?
I’m not a web (app) developer. I’d just like some knowledge on how user input might be captured and why repeated inputs aren’t screened out?
If anyone could page the two awesome doods who work on devRant, that would be awesome! I hope I didn’t just wrongly assume their genders.5 -
Be me. Use DDG to search for nearby bowling alleys. DDG provides reviews in form of Yelp. Click "read more" on review. Yelp transfers me to a bogus url, which prompts
"Open in Another App?
Would you like to leave DuckDuckGo to view this content?
No Yes"
And then, without letting me click "No", I get automatically transferred into Yelp's page in the app store, and if I try to go back, I just get redirected again.
Fuck off. I just wanted to read your reviews in the browser. I had no interest of downloading your app just to read a couple of reviews, and I most certa-fuck-inly have no desire to download your shitty app now.1 -
Who would be interested in reviewing an old peice of Python code I wrote..? It's a few years old, and it uses basic procedual generation to cypher text (entry, or ASCII files) using a hashed password. It's a command line tool.
I used to brag about how "secure" it was, and now I'm curious if it is secure or not.
I plan on picking it back up and open-sourcing it, but I want to know what problems might be wrong with it now.9 -
Dear @devRant, when a rant contains a link and I click it, it doesn't open in a new tab so when that happens, I have to click back on the browser which is not fun.
Can you please open the links in a blank tab.
Thank you :-*9 -
I am writing an api to get data from another api, mix it with some data from a database and then send it back.
I am using nodejs (javascript) to write it but I would like to learn something new. Can you recommend me any languages that I could use for my backend? I was thinking maybe go but I am open for ideas.10 -
Frustration at its peak !!
So the CTO of the company I recently joined, whom I considered to be cool personality of all the open culture in the office and open communication, seems to be all wrong.
Few days back he suddenly dropped a mail to all the tech team members mentioning that we need more streamlined process in the company and many more blah blah stuffs... to which all of us agreed.
But. But. But. The last line(small font size) mentioning that from now onwards we need to come on Saturdays too until further notice. I mean WTF !!? Seriously.
But today in stand-up when one of the guy asked the agenda, he just tossed the question saying that we need to be more active attending "client tickets". Goddammit. We are devs, not tech support.
To this one of the other dev, said the exact same thing that was going in everyone's mind. Call the team that are required on Saturdays. To which his reply was, " Come on Saturday, we will speak then".
I was like 👏👏👏
P.S. Not that we are not ready to come on Saturdays, but at least take consent of all the members in the team, if you all babble so much about open culture and shit. We have friends and family too to have fun with, and need to take little rest on weekends.
And most importantly, tell us some firm reasons to be there on weekends, not just "You have to come, because we said so!"
Period.2 -
<warning>bad words</warning>
WHAT THE ACTUAL FUCK!!! LibreOffice Impress is a complete shit!! I am all about open source and such but this shit just sucks, moving elements around a frame snaps them to some grid, however when you paste an element from other frame it will have a different grid!!! This motherfucker has got an ALT function that will allow you to move the element more precisely but it only works seldom and it hates it when I try to use the fucking arrow keys - it even crashed once when I tried it. AND WHEN YOU FUCKING COPY A TABLE FROM ONE FUCKING FRAME TO ANOTHER MOTHERFUCKING FRAME, DELETE A FEW ROWS AND THEN COPY THE FREAKING TABLE BACK IT WILL HAVE MAGICALLY DIFFERENT DIMENSIONS BUT JUST EVER SO SLIGHTLY, BECAUSE FUCK THE USER, RIGHT??!!! (Doing this because there is no way to split tables into two different objects) I constantly have to save my presentation, kill the process and open it again because something just stops working or gets stuck, like seriously, WHAT THE ACTUAL FUCKING FUCK???!!! Are there no tests?!!! Do the people who work on this piece of motherfucking shit even use it???!!9 -
I label all packages I know are coming as being for a company: Derp Industries. This is from an old in-joke between my friends and I. This tells me whether a package was something I ordered or not from the label (as I often forget I have a package coming.) However, I just got a call from a DHL driver asking me how long we'll be open. I, uh... I told him we close at 8. He said that's perfect, as he has to pick up from the local holding station at 5 and i'm his first stop.
I'm tempted to call back and tell him I'm just a dude living in a trailer...2 -
I have got so much stuff to learn.
I have had little to no experience with Python and JavaScript and was planning to learn the lot during my holidays. Where I'm from, we have a huge ass festival this weekend. So holidays for a couple weeks, at least. Probably the biggest festival in our country. And for the last two months, I had my exams. So no learning back then either. I have so many tabs open to learn stuff but I don't seem to get the time.
So for the last 4-5 days, I've been cleaning the house, top to bottom because its the holidays, the only time I stay home and free. It sucks to do it alone. My parents are getting old and get all sorts of back pain and shit upon little physical effort. So I should get all the stuffs done.
Yesterday, I finally finished my chores at 10 in the evening. But by the time the chores were finished, I was finished too. *sigh* I guess I shall find some time soon.2 -
Just realized that after 3 months of continuous samsung s9 use my phone is still as fast as it was when i got it out the box.
Man I love this stupid phone so much. Everything opens up so fast and this sob is as smooth as an iphone when it comes to the speed.
Pure goodness. Still would like to try a more pure Android environment u know? Like back when nexus was still a thing. I don't really dig the pixel phones too much but know that I am on a more open carrier and I can use phones like the one plus series I think i know what my next phone would be.
Nothing personal samsung, you have been good ans loyal, but i want to play with more phones.
I really love smartphones.2 -
This moment when your internet provider kills your VDSL for four months and offers you a 5GB LTE SIM as a replacement...
Not that I burn through hundreds of gigabytes a month or so...
Gosh sometimes I hate ISPs.
Apparently we quit our contract (we didn't) but they just internally fucked up and nobody could tell us what happened. Finally after directly contacting their management we got service back...
But hey an old laptop at the open window relaying all traffic through the barely receivable WiFi of our generous neighbors at least made devRant available :'D -
I just contacted the support of one of our service provider for virtual tours. I told them that the iframe will open the website (in target self) instead of playing the tour, and that our clients will most likely not come back to our site, when they don't see a "go back" or something. Best would be, if the iframe plays instead of opening a new tab.
Supports answer: "I sent you a video, there you can see how to get back to your website"
*sends a video of themself opening his browsing history and clicking our site*
A dream of every UX developer.2 -
My manager during my internship in 2007 was very prone to screaming.
She took the position, because more senior staff than her didn't want it and she wanted to be in charge of them.
When people didn't deliver the results she wanted she would call them in the office, start yelling them and saying they were incompetent and demean them. And even though we were a small open office, she would send us messages through MSN Messenger (it was the it thing back then), to check on our progress or ask us to go to her office which was the room next to us.
I met many wonderful people during my internship, but I was more than glad when it finished. A couple of years later I've learnt that the branch she was managing was terminated because everyone slowly started quitting. I can't imagine why... -
I just played a few old maps I and a few steam friends made and it brought back the feelings. I had to open a few maps in hammer (Level editor) and see myself around.
I completely forgot the controls in hammer and had difficulties to recall how to import assets from a custom map. Everything was clunky.
It kind of makes me sad when I look back. I wish I could still map - but the school will start tomorrow and I guess I have no time for that. The same thing happened with playing the piano. Once I reached a certain skill level, I stopped although I loved it. I stopped progressing.
Unreal engine isn't fully my thing, I feel uncomfortable working in it, though I still want to make games. I found myself not opening it for a month or so.1 -
I just love customers:
Customer: "ftps doesnt work! It says Port blocked you are using the wrong port! Fix this now!"
Me: "did you open the port and allow it through the firewall?"
C: " yeah ofc i opened the ports on the server! Do you think i'm stupid?"
M: "On the client too?"
C: "...."
C: " let me call back in 30min" -
Me: Ok I've updated the docs, I'll open a PR with the changes
Maintainer: Looks great! Can you remove the changes to the package-lock.json? (I assume it got updated when you ran npm install to start the webserver)
Me: Ok sure, I'll update it soon
And this is where the troubles begin. The file was commited 2 commits ago, so I have to roll back to then. However, the remote repository has been updated since then, so I git fetch to keep up to date.
This makes the rollback a hell of a lot harder, so I run git log to see the history. I try a reset, but I went back to the wrong commit, and now a shit ton of files are out of sync.
I frantically google 'reset a git reset', and come across the reflog command. Running that fucks things up even worse, and now so much shit is out of sync that even git seems confused.
I try to fix the mess I've created, and so I git pull from my forked repo to get myself back to where I was. Git starts screaming at me about out of sync files, so I try to find a way to overwrite local changes from the origin.
And by this point, the only way to describe what the local repo looks like is a dumpster fire clusterfuck that was involved in a train wreck
I resolved the mess by just deleting the local copy and git cloning again from my fork.
I gotta learn how to use Git better5 -
I’m really bad at closing my tabs. I’ll often have 40+ tabs open when tackling some sort of problem or when doing research. Sometimes I’ll crack open another browser instance to research something unrelated. I use a tab session saver to save all of my instances before a reset. But the funny part is, I almost never go back into my stored sessions. I’ll just open up a fresh browser after restarting and the cycle begins anew.
I need help.10 -
Pet peeve: the claim that static typing prevents errors.
Today I worked on a C# project that's a mess of nulls, side-effects, inferences, and race conditions. Then I went back to a JS project that's twice the size but written in a clean, well-tested, FP style and currently has fewer than 10 issues logged.
Look, I get that there are upsides to static typing, and I'm open to introducing typescript or flow for our JS code.
I just can't stand the faux-concern from the static typing dingleberries when they are the ones who produce these horrendous lumps of unmaintainable shit, and the JS/Python/Ruby/etc people are over here quietly reinventing functional programming and code modularity.10 -
My Top 10 most useless keys (#1 is worst):
1. Stop (the media key).
2. Pause/Break. (I understand this has historical usage, but I personaly have never used it.)
3. Page Up
4. Page Down
5. Scroll Lock
6. All those little shortcut keys along the top (above the F-keys) which open things like IE, My Documents, email etc.
7. All the modifier combinations of back tick (it in itself is useful, but WTF is a split pipe supposed to mean!? Or a ¬ !?)
8. Right Windows key.
9. Insert. Again, it has historical significance, but it's completely useless! Especially when you press it by accident.
10. The Menu key which opens the context menu.
I know some people will probably say 'the [blah] key saved my life once...', but I just rebind these keys with AHK. (http://autohotkey.com)7 -
Wasn't a "real" interview, but a simulation, with a internship maybe if the HR is convinced. Yeah, not a real interview but with a job. whatever.
So I made my interview, and the guy was also there to tell me what's good, what's wrong and give me some tips for my CV.
But since it wasn't official, he told me with a big smile that I should cut my hair because that's not "clean".
And it was one of the big lines of his feedback.
Worse is, he asked a friend to remind me that, and since he said he will send by email the recap of the simulation, told me one more time to cut my hair.
Well, I got an internship somewhere else, they were more open-minded to hair apparently.
Seriously, that asshole pissed me off that much back then. -
Tabs, or No Tabs? I did the same as this commentor 2 years ago. I can code so quick now because of this simple switch. Here's why:
(source, Laracasts.com)
Ben Smith
"I think the most beneficial tip was to do away with tabs. Although it took a while to get used to and on many occasions in the first few days I almost switched them back on, it has done wonders for my workflow.
I find it keeps my brain more engaged with the task at hand due to keeping the editor (and my mind) clutter free. Before when I had to refer to a class, I would have opened it in a new tab and then I might have left it open to make it easier to get to again. This would quickly result in a bar full of tabs and navigation around the editor would become slow and my brain would get bogged down keeping track of what was open and which tab it was in. With the removal of the tab bar I'm now able to keep only the key information in my mind and with the ability to quickly switch between recently opened files, I find I haven't lost any of the speed which I initially thought I might.
In fact this is something I have noticed in all areas of writing code, the more proficient I have become with an editor the better the code I have been writing. Any time spent actually writing your code is time in which your brain is disconnected from the problem you are trying to solve. The quicker you are able to implement your ideas in code, the smaller the disconnect becomes. For example, I have recently been learning how to do unit testing and to do so I have been rewriting an old project with tests included. The ability to so quickly refactor has meant that whereas before I might have taken 30 seconds shuffling code around, now I can spend maybe 5 seconds allowing my mind to focus much better on how best to refactor, not on the actual process of doing so."
jeff_way Mod
"Yeah - it takes a little while to get used to the idea of having no tabs. But, I wouldn't go back at this point. It's all about forcing yourself into a faster workflow. If you keep the tabs and the sidebar open, you won't use the keyboard."2 -
The amount of repetition and vagueness in this unsollicited recruiter job invite is insane: "Current Technology Sector Consultant". I've had 10's of invites from these recruiters on Linkedin, blocked all of them and they just keep coming back despite my Linkedin preference being set to let recruiters know "that I'm NOT open to opportunities"
If you ever get an offer from VMR consultants / J People consider these reviews carefully: https://glassdoor.co.uk/Reviews/....
I'm naming the company because it seriously deserves to be exposed for its bad practices towards both their potential and current employees.3 -
Got my iPhone 7 today an directly proceeded to brick it. Got an issue open with 2nd line support that are going to get back to me tomorrow.3
-
Mac OS X has finally gone open source !
You need to run custom scripts to get basic behaviour back 🤣🤣🤣🤣
Thanks Apple ! 😘
https://github.com/luckman212/...3 -
LinkedIn sends me notif about an InMail. I open it via the notif. I close the app. The notif count badge is still on the app icon. I open the app again. Go back to the message. Close the app. Now the badge is gone.
Good going LinkedIn 👌2 -
I give software support to Rugged handhelds in a company and everyday some IT support moron comes to me with a crazy request. The day just started and...
IT Tech: "Hello, C, can you improve the touchscreen sensibility? It's not so responsive and sometimes we have to click more than one time to something work"
**breath in**
Me: "That's ok, the rugged ones that you have are very old, besides they have resistive screen, so your fingers won't do a good job"
IT Tech: "THERE'S NO WAY TO FIX IT? I guess I'll open a ticket for you to study more calmly about the issue"
**NGGGGGGGGGHHHH**
Me: "If it's not a software thing, I can't do that, I don't have hardware skills, I guess you'll have to call our provider about that, but, before you do something, try to recalibrate your handhelds, the majority of the users don't do that at the system's start and the touch experience really can become a mess"
IT Tech: "Hmmm, I'll try that, otherwise I'll back to you, thanks!"
OMFGGGGG
I am open to suggestions of a magic batch file/ .NET CF 2.0 software that will turn their handhelds into a Galaxy S6 touch experience. THANKS!1 -
So a few days ago I sat down to write a redis adaptor to transfer data back and forth between redis and elasticsearch. I download the go-redis package and start writing a simple client.
I run the client and it gives me an error. So I'm stuck at it for about 30 mins and then I say to myself, "You dumb fuck you haven't started the redis-server". So I open up another terminal and type in `redis-server` and then I realise I don't even have redis installed on my machine.
I do such dumb things every weekend. If you have any dumb mistakes you made while writing code please share them in the comments. :-) -
How do you deal with anti-competitive clauses in contracts with your employer?
I have found them to be unavoidable here in the field of IT/CS related fields, and I don't want that to affect my future career as much.
My current strategy is to gain more of other skills than just in software development, so I can fall back on those skills for a different field (e.g. DevOps, sysadmin, ...) instead of being unemployed for a year because I didn't like my workplace anymore.
The only other way I can think of would be to open my own company, but I'm not going to be ready to do that right after school.
Any other thoughts?3 -
Caught up enjoying myself last few months , of using Linux (Ubuntu) O.S
Now, I won't be switching back to Windows ,
I mean who will not enjoy an open source O.P that doesn't generally need a machine reboot and isn't vulnerable to malware , viruses7 -
One month ago, two tickets were opened by two different people for the same bug.
I picked the one with the most informations and rejected the other by giving the ID of the other ticket, and then assigned it to the person who opened the ticket.
Today, I see that ticket coming back to me, with the status back to Open, and the comments "The ID given is this ticket's ID!"
I mean, yes, I did a typo and typed a 5 instead of a 6.
They could, like, test to see if it was patched (been one month), or contact me by mail or Skype to ask me if I didn't make a typo in the comments, but no, they decided to reopen the ticket for this.
Thanks. -
So decided to take a step back and build an interpreter for a custom version of BASIC for the cosmos kernel and a way to learn python but can we just take a moment to admire how BASIC is designed...
It is such a well designed, open and malleable language to design for specific needs...
Except visual basic, fuck visual basic, fuck it with a rake...4 -
So last year I sent my PC to get a motherboard replacement, as I couldn't be arsed replacing it or even research what motherboard I should get(was dealing with more urgent personal matters).
Anyway, I get it back and everything works good but not the front USB port.. I always found it weird, but also didn't bother to open the case and double check, so I let it go and assumed, since the motherboard was fried, that the USB wires were faulty.
Time passes by and I decide to open the case for annual cleaning job... Turns out the motherfucker didn't connect the port, why?? Fucks knows why... Obviously the wires were "short" and he didn't even try to pull it out further!!! You little piece of shit,for a full year I've been living with a missing usb port, the fucking front facing mother fucking usb port. Fuck.
Moral of story? Don't be a lazy ass and fix your shit on your own!4 -
Way, way back when IBM discovered, gasp, that the largest gain in programmer productivity was giving each one an office. Have also read it takes 15 min to regain train of thought after an interruption. What is pair programming doing to us and worse open offices? And phones?6
-
Ask to get DB back ups done, contact DB team => cant log in => have 2 contact wintel team => they believe a reboot will sort it => contact customer => permission to bounce given => contact team to bounce => shifted back onto DB team => bd team open lync conversation about bouncing => no reply to mails if all is well in the world => sit at desk cant start dev cuz know will be sucked into aroganizing this brewery piss up with a bunch of bums....... cue putting on headphones and blasting some music at 11 ,,,,,,,,,,,, been waiting to deploy for 4 hours !!! FML2
-
Wtf is happening to tech security... Last 4 months
All WiFi is now crackable. .. in short amount of time
Windows . . Annihilated with this new bug might not be fixable... and work back on all of them
iPhones cracked ...
Linux dirty cow ...
Android been suffering.
And everyone knows Mac's security is joke ...
Finger prints ... Made pointless on everything.
Literally all going to shit .. 😐
And I know how to do all this... It's all out in the open not even hard to find8 -
I used to come here when I was 16, I am 20 now. I got better back then due to the discussions I had with random people here. So I wouldn't ever forget devrant.
>why am I back
I came here to take screenshots of few interactions that eventually pushed me to get into open source. (I am gonna give a talk on it tomorrow). So thank you all and thanks to the creators. I am gonna stick around for a while now.
Hope someone remembers me (and vice versa)1 -
So it's 2018, I thought let's start working with Android Studio on Ubuntu. [Due to some guy who posted his CPU usage on a very heated rant of same issue]
I realized it's fucking mess(/shit) and you dare not keep any browser open in back/fore-ground. Now, my entire system is stuck.
Ruined the first day man. -
Trying to make use of Google Maps. Search results are always sorted by "most relevant" by default, instead of by distance. Always I switch to distance, next search goes "most relevant" instead, which should be labelled "most irrelevant" instead, as it seems to be an excuse to show a list with promoted businesses not only far away, but often unrelated to my actual query. Wasn't Google supposed to be some sort of search engine experts? or at least the lesser evil of search engines? Oh wait, no, they're actually an advertising company, and it shows. Fuck you, Google. Where am I going to throw my Pixel phone and why did I open your shitty apps in the first place? I should switch MY own defaults back to Open Street Map etc.4
-
Metalsmith is an older but still awesome NodeJS static site generator. Due to metalsmith's original founding company not having done a complete open-source ownership transfer however, active development has stalled for years.
I am super-happy to have been accepted as a member of the Github metalsmith org today in the role of maintainer. Hope I can help bring it back on track. If you're curious please npm i metalsmith and head over to the newly created Gitter chat to share your input: https://gitter.im/metalsmith/... !2 -
"I might need to come back to this page later" always leads to about 50 tabs being open and me just opening the site in a new tab because that's just quicker than finding it.
I need to get better at managing this2 -
- finish that ML course I started back in June 2017
- get more experience from my job
- improve my code quality even better.
- build some cool project in Java ( there's this company I need to impress, but I haven't found any good idea to implemen 😣)
- be more active on Hackerrank
- do some stuff here and there
- use that freaking LinkedIn to create some meaningful connections
- contribute to an open source project
Hmmm ...
... yeah that's a lot ... *sigh*7 -
Monitoring tools madness: quest foglight.
So, setting a blackout for an FMS "HA cluster" (which does not work due to a bug infested custom jboss implementation) can bring the servers down... And no way to bring them back up.
This brilliant piece of enterprise APM software costs 600.000€ for a 5year license.
I,ve added more drama (logs, threaddumps, support bundles and screenshots) to the support portal...
45 cases now in total, oldest case still open date 2017...
Fuck you quest software4 -
So get this, I try making an appointment at the bank twice, they don't call me either time so I call them and they say they'll call me back sooo they never call me back. So today I go to the bank office because fuck it right ill just come in then and guess what I'm told? Oh euh you need an appointment to open a business account LIKE FUCK YOU YOU TWAT I TRIED MAKING AN APPOINTMENT FUCKING TWICE2
-
I recently went to an office to open up a demat account
Manager: so your login and password will be sent to you and then once you login you'll be prompted to change the password
Me: *that's a good idea except that you're sending me the password which could be intercepted* ok
Manager: you'll also be asked to set a security question...
Me: *good step*
Manager: ...which you'll need to answer every time you want to login
Me: *lol what? Maybe that's good but kinda seems unnecessary. Instead you guys could have added two factor authentication* cool
Manager: after every month you'll have to change your password
Me : *nice* that's good
Manager: so what you can do change the password to something and then change it back to what it was. Also to remember it keep it something on your number or some date
Me: what? But why? If you suggest users to change it back to what it was then what is the point of making them change the password in the first place?
Manager: it's so that you don't have to remember so many different passwords
Me: but you don't even need to remember passwords, you can just use softwares like Kaspersky key manager where you can generate a password and use it. Also it's a bad practice if you suggest people who come here to open an account with such methods.
Manager: nothing happens, I'm myself doing that since past several years.
Me: *what a fucking buffoon* no, sir. Trust me that way it gets much easier to get access to your system/account. Also you shouldn't keep your passwords written down like that (there were some password written down on their whiteboard)
Manager: ....ok...so yeah you need sign on these papers and you'll be done
Me:(looking at his face...) Umm..ok4 -
Was recently in a motorcycle accident and haven't been cleared to go back to work yet so I'm trying to build my first Android app.
I don't know Java, XML, kotlin, Android studio, or what the fuck a Gradle is; but I figured I'd take my app idea and download Android studio then try winging everything from there.
Needless to say, I'm having a damn hard time lol. I have been watching firebase tutorials on YouTube to try and figure out how to add authentication to my app. I kinda got it working in the AVD. But my personal Google account has 2FA enabled so I can't seem to get the app to sign me out, or sign me back in. (I was able to authenticate once successfully.)
I have no idea if having 2FA enabled is even the problem. I tried turning on debugging and can't seem to figure out how to actually get the app to debug or get a debug console open.
I seriously feel like the world's biggest n00b right now. Going to go YouTube/Google how to get the debugging working. Then I'm off for a round of learning how to read a debug report!
Hahahaha... Kill me now -_-'2 -
Today I came across a very strange thing or a coincidence(maybe).
I was working on my predictive analytics project and I had registered on Kaggle(repository for datasets) long back and was searching on how to scrape websites, as I couldn't find any relevant dataset. So, while I was searching for ways to scrape a website, suddenly after visiting a few websites, I get notifications of a new email. And it was from Kaggle with the subject line
"How to Scrape a Tidy Dataset for Analysis"
Now I don't how to feel about it. Mixed feelings! It is either a wild coincidence, or Kaggle is tracking all the pages visited by the user. The latter makes more sense. By the way, Kaggle wasn't open in any of the tabs on my browser.1 -
I had a company event last Friday and the CEO announced to go back to 2 days in the office.
And a bit later, he went on a spiel that employees should disable notifications more to focus. But he wants that we go back to the office... an open office with a lot more background noise.
My closest colleague that I work the most with is 2000 km away....2 -
A bad dev habit I should unlearn?
How about being too stubborn to take an idea out back and put it out of it's misery. You know what I'm talking about. Got some elegant idea in your head, it looks so pretty and masterful. You begin to implement it but straight away, things start looking pretty fucking ugly. You persist though, and persist.
Sooner or later that pretty idea looks like Donald and Hillary decided to spawn a love child. You close your eyes and grit your teeth, unwilling to put the abomination out of it's misery.
You stop and finally open your eyes to look at what you've done. A hideous beast with Gary Johnson's nose, Bernie's voice. Donald's hair, and Hillary's lips stares back at you. Yeah. Now you've wasted hours upon hours and only have a mistake worse than the 2016 American Presidential Election to speak for it.2 -
Good old dear me sitting comfortably and writing some code...
Suddenly, the doorbell rings!!!
"One moment! Coming!", I shout...
I proceed going to the hall, take the keys from the table right next to me and I unlock the door...
I open it and there's only thin air in front me. Downstairs I hear the building door closing and the elevator working its way up, higher than my floor...
I close the door and I go back to my desk, resuming my work and thinking:
"I don't know who are, I don't care who you are, but I will find you and I will make you pay..."
Now my coding train of thought has stopped! Thanks, unknown doorbell ringer!!! -
So CRA(create-react-app) v2 rolled out.
> started new project with my own boilerplate
> little did I know, I am accidentally doing int CRA2
> gulp-sass fails.
> Internal screaming.
> Bulma React Components fails to compile due to one type, IDK how they missed in previous build.
> fixed by removind browserlist array from package.json
> Guess what, it comes back as you close it.
> So, now I've to keep it open while gulp-sass is running, which is almost always, in order to compile.
Thank you and Fuck you facebook5 -
So this week I picked up some Sennheiser HD 600 phones for my listening pleasure and take my mind off life stresses.
At work I've been using some Bose phones, but these Senns being open back may be a little loud for the neighboring cubicles.
I guess sound quality and all day use are mutually exclusive. Anyways, what's coding without some great indie tunes. :)
BTW, they sound amazing!!2 -
Working on a project, got stuck, thought to call it a night but nooo. Fucking brain decided to come up with a solution 0.0000001 ms right after I shut my eyes. Now I am way too tired to open my laptop back again and I am forced to use Facebook Graph API on my cellphone. FML
-
A former team lead decided the team should review any open PR before proceeding with their own tasks after their breaks. Any open PR also meant reviewing refinements in an ongoing discussion. Several times, we wasted time for review, coding, and discussing when the second reviewer asked to revert the changes introduced according to the requests of the first reviewer.
Now as a freelancer, in smaller projects, I sometimes have no coworkers to review my code. So, apart from testing, I try to pay more attention to linters, static code analysis and automated coding assistance. I have stylelint, eslint, SonarLint, and possibly some more IDE inspections. For the infamous popular blogging software, I also have a so-called PHP code sniffer that checks all PHP and JavaScript code for compliance with the WordPress coding styles, so finally, I got the team experience back: SonarLint suggests removing unnecessary spaces and reformating my code, which in turn makes PHPCS complain that the code violates the legacy code style. -
Who here works at Apple in the Finder group. OMG, would you please fix shit? Finder has been such a bag of insects for years.
1. windows don't right-size to any reasonable minimum in icon view when there is one row of icons
2. text color of files and folder names no longer adjust to accommodate background color changes. Setting the window background color USED TO result in white text of the files and folders displayed in that window. Now it is Black-On-Black oh so readable 🙄
3. stop re-locating 0,0 in the god damn folder icon view. Finder items in grid view cannot, by themselves, get disorganized off the grid.
4. Stop moving the god damn folder/disk window locations between open and close
5. stop resizing the god damn folder/disk windows between open and close.
6. stop destroying the contents of clipping files. I get so tired of losing data to mac-unix programmers who think they know what the f they are doing at the file level. Resource forks were rocket science you just could not understand and you have really rolled the clock back on macOS file system to Stone Age 1980s tech.11 -
What a consultant's gotta do for his timesheet when homeworking:
1. Fill in Excel, send to self by mail (corporate bitlocker protected PC on proxy that doesnt allow local printer connections)
2. Go upstairs to secondary Windows PC (no Excel on main Linux laptop) and open mail
3. Send to printer, wait 10 minutes (old printer needs to 'warm up')
4. Sign timesheet and go back upstairs
5. Scan signed version, send mail to self.
6. Open personal mail on corporate laptop, send to manager. (can't send directly from personal mail)
7. Wait to get back signed timesheet from manager
8. Finally, send to own admin dept.
2 story points completed, time for a break.1 -
I'm so tired of all these new support channels. Why the fuck would I want 7 electron based apps/accounts just to ask questions or provide support? I don't want slack, gitter, discord, zulip and what not. Can't keep up with this bullshit.
Can we please get back to supporting open source on IRC? And fuck my life even that got split up due to shit happening in freenode (the company). FML distributed good, fragmented bad.3 -
I remember that when I was about 8 years old, my dad brought a desktop computer home one day.
I don’t remember any specs, but it had a huge ass CRT monitor, a very loud clicky keyboard, a mouse with a real ball inside, and a CPU that uses floppy discs and CDs. Nope, CDs, not DVDs. And on that computer, it ran Windows 95. There’s was no internet most of the time (it was still quite expensive and unnecessary and dial up was troublesome to set up back then).
I remembered playing bootlegged games sold in CDs that my dad bought during his trips to China back then. Duke nukem, Command and Conquer Red Alert 2, Microsoft solitaire and GTA 3. Those were the games I played.
As a kid, it was glorious, looking through a box on a table, seeing and interacting with so many different worlds, stories, characters and games. I really miss those simpler times.
These days, every time I open my laptop, and I see that new mail that need to be dealt with, that homework that’s about to be due and a reminder of my next class in 15 min. Well shit.1 -
Losing faith in Netflix and their awesome open source projects.
Had a hard time trying to install Security Monkey : poor quality quickstart Ubuntu-only, almost no documentation, same instructions for latest (aka dev) and stable (aka prod) version, no depencies list ... oh and the UI display well only on Chrome ..
Then you surrender and just want to check the dockerized version they provide : it doesn't work neither (build fail or back end process just shut down) !!
I'm done ... -
I HATE WINDOWS' WINDOW MANAGEMENT. I have two monitors and nothing can be maximized. Windows' spaces are terrible as well.
I am building in the back end in VS Code.
I have three terminals open because I need them to run multiple parts of the app locally.
I have postman open to try requests.
I have firefox for the orm system's documentation.
I have my database tool running as well.
I have an ERD diagram floating in a window.
I have another VS Code window showing a diff of my JSON compared to the version I'm replacing.
Also all of my team communication tools.
I have never hated shuffling windows around so much. Would it kill us to use some command line tools for http instead of Postman? Could we please get a decent shell in windows? Could we get some simple ways to switch between virtual desktops? Click click click. I can't automate clicking. Why do we use the most clicky tools we can find?17 -
Do these stupid tech writers even research what they talk about, if it's not the same 5 points as every other article on the topic then it's an article written this week on '5 Open Source HTML and CSS Editors and they mention Brackets.
Fair enough... but they link to the adobe Gitub, saying it ""isn’t super actively maintained"" which I guess is accurate since it has been dead for 2 years. Rather than the more recently updated 'brackets-cont' project that had a release back in October 2022.
Like fuck it's like these tech writers just pump out content years after it's relevant without any research or editing.
Pointless complaining I know but it bothers me how mindless mainstream tech writing is, it's all the same regurgitated ideas, or outdated information. Not saying I could fix it, but I'm sure someone out there can do something.1 -
Legend says there is an Atom installation where the "Open empty editor at start" option actually works.
I don't know why but it never worked for me. First the editor always opened a specific file I hadn't edited for days, now it always restores the previous session and opens TWO fucking tabs with the welcome page.
Back to Vim.7 -
While I was in my computer science bachelor, I had the VERY best coworkers. I would always make group projects with my friends BUT I decided to open my horizons! So I tried to find other classmates to work with.
ANNNNNND it was terrible...
Here’s a little list of why they couldn’t work during the projects:
_ Dude, I left my charger at home (I had one to share)
_ I’m gonna eat! (He never came back)
_ Sorry the wind is too strong, I can’t even open my door. I won’t come today! (It was just another rainy day in Paris)
_ Crap, I forgot to tell you it’s Chinese New Year today, I’m with my family! (Ok, no problem but he was missing 2 WEEKS! The time of our project)
And maybe my favorite:
“SORRY, I CAN’T JOIN YOU I DIDN’T MANAGE TO OPEN THE DOOR OF THE BUILDING”.
(The building was our school building and it was WIDE open...)
Fact is when you study computer science, it’s easier to work online with your coworkers but these one... They just never came online.
I think, now, no coworker can hurt me x) -
Open Visual Studio with existing project. After a while closed it due to accidentally clicked the close button.
Open back the Visual Studio again...
Opening the recent project...
**Project is (unavailable)**
Is okay, I can always close and open it back again. And I have done it!
The previous opened tab all is gone.2 -
Stepped away from the computer after doing a bunch of work with a bunch of programs open. Come back to find it rebooted itself AGAIN with no prior warning despite my having set preferences to keep it from doing so. Son of a ...2
-
An app I'm making for a client currently has 23 "pages" that are simply web views.
Most of those pages have A HREFS which open other pages (some external pages that I have no access to as a developer).
Of course, some of the links aren't HREFS and are javascript calls to change the content on the screen without going to another page. So the user thinks they have gone to another web page when then system doesn't recognise it as another page...
Additional to this, there are multiple versions of the pages depending on which language the user has selected in the app.
And nobody seems to have considered how the default back button handles all these possible eventualities (whether it can go back to previous web page, IF it was an HREF and not just JS mimicking a new page (and how would my webview even catch that), and of course IF the language hasn't changed during the user journey etc etc)
Am I wrong for being annoyed about this? Am I the dick for not developing a clean solution to it? Or am I justified because webviews have no place inside an app!
I'm sort of hoping apple deny this app due to too many web views :S8 -
I'm founding a company on machine learning with two others where one of them is an economics guy who decided his work was boring so he did his PhD in Engineering.
He started about three months ago to also invest some time in computer and dev stuff.
As a free software and Linux guy I wanted to get clear about stuff like open sour...
Economics guy: "We should definitely make all of that stuff open source to give back to the community."
Me: I love you. I truely do.
The same thing happened with security, svn etc.
I mean... Well... So unexpected! o.O2 -
One of the DB guys at work writes DB packages like this:
- open package in PL/SQL developer
- copy code to notepad
- edit PL/SQL code in notepad (yes, fucking windows notepad)
- copy and paste back from notepad to PL/SQL developer
- commit
Everytime I see him edit DB packages I can feel my brain mass shrinking.5 -
Some background to get us started...
Just took over the position as IT Specialist for our local county commission back in December after the previous employee left.
Before leaving she deleted all of her emails for the past 9 years.
Included in her emails were the details for certain program licensing the county had purchased not the least of which was 200 Office 2010 professional keys.
Getting into the office this morning my boss says "Hey got a problem for you, we've exceeded the license count for Microsoft office, and the vendor we purchased from is no longer in business."
My first response was Ok, lets go with open, or libre office. Problem solved. (I'm piece by piece upgrading our infrastructure to a more dependable OS you know, Linux.) I knew the open office suggestion wasn't going to fly so I promptly got on the phone with our friends @ Microsoft.
They were as helpful as you can expect when provided with only our MAK # and sent me back to try digging around for details 9 years old with our purchasing department. Who happens to be too damn busy to concern themselves with what the IT department needs this morning.
That will be remembered the next time the internet "Quits" working as they so often like to claim when then cant get an item to add to a cart in amazon.
Sure people just because your chosen shit browser (Edge) doesnt like to play well with js all the time the internet must be broken... -
So I bought a new phone, I was super excited getting it, I even got to open it at work with my colleagues watching. It was really nice, the S8 is an attractive phone... Until it started crashing very very regularly. I want to go back to my old phone, that's how bad it is. Turns out this is a common experience, how can this be at the top of all the review lists if it has this problem? Is the assumption that you are going to install stock android as soon as you get it? Or is someone paying for reviews?4
-
are you able to give 1/+ hour to any hobby project/self learning (technical, that could help you in infuture switch) ? if yes, HOW??
I want to create this website , but i keep on delaying that. i just have a faint idea of how the assoc technologies would be used , but putting even 1 hour aside becomes difficult once i come back from the gym in the evening. plus the effort to open laptop, refocus self and do something only to close laptop after an hour feels very less rewarding. I can't achieve anything in 1 hour, i need a continuous slot of 6+ hours to achieve something and plan for the next day.
do share any better mind makeup9 -
I just hand to share this.
Got back from shift, currently 12 am.
Trying to cook rib eye. Went to grab skillet, accidently over a open flame. Heard a crackle and felt some heat.
Looked at forearm and I noticed that some of my arm hair was missing. It freakin burnt off and I could smell like something had burnt.
Wtf. I'm okay though. Just couldn't stop smiling. 😅
I didn't feel any pain though so just glad11 -
Wasting 7 sheets of paper because of this fucking HP Officejet(6600). ALL I ASKED WAS TO PRINT THAT FREAKING 14 PAGE LONG DOCUMENT AND YOU WITH YOUR FUCKING OWN MIND LET ME UNSTUCK YOU 7 TIMES!!!
Me: Sends the document to the printer.
Printer: Let's do like I am going to print.
Printer: let's show the "document stuck" message
me: Let's open the back and remove the paper.
Printer: let's show the "document stuck" message
Me: Just pressed OK and it continues
WTF YOU AREN'T EVEN STUCK YOU FUCKING STUPID PRINTER.
Looks like every time I send a file to the printer at least the 1st sheet will troll me with that message.
Printer is asking for some free base jumping from the window lessons.1 -
Some script keeps freezing my firefox while facebook is open. Hell, I only ever use it to chat with people...
I already went to hell and back and can't seem to fix if.
No other site does it, already cleared cookies etc.
I really don't want to switch to another browser...7 -
While showing the rest service demo a senior 10+ years dev ran into session issues in chrome. I asked him to open private/incognito. He opened ie,edge, closed all chrome, tried back, nothing. Had no clue whatsoever.
At last I asked him to do ctrl shift n in chrome & dark chrome opened up where he could use the test accounts to validate the bugs. He is still confused what happened4 -
So I wanted to publish the spherical voronoi minesweeper on steam. I paid the one time fee, submitted my tax document and then never heard back, and that’s four month ago.
Shall I just open source it, it’s a unity project so idk how the structure of that should be.
I can also just put the built version on github, if the file size is not enormous.4 -
In highschool I started by setting up an open tibia (OT) server for which I copied and edited lua scripts to create spells and quests. Didn't do anything remotely difficult in those times.
In university I needed to learn and use Prolog. And soon after that I had an OOP course in Java. Didn't really learn Java during that course. And started to accept I would never like real programming.
During a Datastructures course I actually got the hang of java and started to program in my spare time.
Finished the Datastructures course with a good grade which landed me a job as student assistant for a python course.
That job in turn landed me a part-time job as python developer where I learned most of my programming skills.
Now I'm back to working in Java and I still learn everyday. -
AAAARGHH!!! It happens every now and then that when I open a window in a Windows application, the window opens outside the display area, on a non-existing display to the right of my primary screen. There is no other way to access the newly opened window than to go to "Screen resolution" and swap screens 1 and 2 such that the secondary screen thinks it is to the right of the primary screen (although physically it stays to the left of the primary screen). And then, once I've got hold of the window, I swap the screens back. It's just so incredibly annoying and a complete waste of time. This is staring to really get on my nerves! >:(8
-
Way of wasting time:
generating csv and importing in Open Office Calc, mysteriously what should be ",-," shows as "-0".
I thought some strange fucking time function was responsible of generating a "0" after my "-", until I discovered that for some fucking reason, Open Office Calc decides to add the fucking "0" by itself.
And they say that computer do what they are told to. I just said to import a fucking "-", it's called "Minus". do you fucking understand Calc?
Back to something useful.1 -
Assuming Mac: Alfred for OS such as searching and opening apps, using spaces to setup smart project areas, divvy app to quickly size and move around the windows, terminal shortcuts to open files in the OS or in an editor, transmit for hidden files and dragging between panes and server + occasional mounting for preprocessing, inbox-zero mentality, a properly setup google drive app so you don't email forked files back and fourth, beanstalk for deployment of larger stacks, surge.sh for targeted front-end sites, Ember CLI or brunch for build pipelines, CodePen for UI experiments outside of the project, slack instead of email, pick up the telephone and just call for clarification more often, stylus is easier to maintain then scss, hire designers that actually know what their job is if you can. For arduous WordPress administration, rightclick open in new tab for everything - or half your time will be pushing the back button, wp-migrate pro, and in general try to get out of WP when you can.
-
Am I the only one that doesn't think purely data-oriented programming is a particularly good idea?
I mean we're throwing out all the principles that have been established over the last 20 years of OOP like encapsulation and implementation hiding. And you can say what you want about OOP and yes it's not perfect, but there are things that work quite well. Implementation hiding is a perfect example of something that I don't think I just want to give up.
DOP feels like going back to programming C in the 80's with fully procedural functions and completely open structs.
Am I just going mad?6 -
One time I got a Skype interview and the interviewer asked me to complete all the coding questions (rewrite in actual code) and email the answers to them within 10mins.
But when I open the question sheet, I found that all questions contain pseudo answer, so I ended up rewriting them on specific coding language, which was easy.
After I finished all the questions and sent the answer back to the interviewer and she told me this test wasn't testing my skill level on that specific coding language but honesty.1 -
This rant goes way back.
> Be a student with student placement program at a big non IT related company back in the college days
> Given the job to work on a system to digitize their paperwork
> Had to go through 1.5 workdays of bureaucracy (?) to install Notepad++ and other basic open source tools to work with
IT'S JUST NOTEPAD++ NOT THE FKN MATRIX! JUST APPROVE THE DAMN THING!1 -
Outlook is quite bad. There's no way to enable week numbers in the week view. And once you accidentally decline an occurrence of an recurrent event, there's no way to get it back, without having to trouble the meeting organizer to resend the request, or create the event manually yourself. In addition, Outlook is ugly and I strongly dislike how the calendar and inbox are combined in the same application. To me, e-mail and calendar are two completely different things, and there should be a way to open the calendar separately, without the distraction of any incoming e-mail.5
-
So I've made the code public for a tool that I've made using React and Electron. This tool does periodic calls to CircleCI to get the builds that are running. I made this tool because at my job I have two circleci accounts, one via Bitbukkit and the other on GitHub. By running this tool I can get the previous build numbers in a pinch without needing to open up another tab or logging out and then back into another account to get the builds. None the less, Enjoy.
https://github.com/nhalstead/...1 -
Currently debugging a project that was written over 4 years ago...
At first all was well in the world, besides the ever present issue off our goddamn legacy framework. This framework was written 7 years ago on top of an existing open source one, because the existing one was 'lacking some features' & 'did not feel right'.
Now those might be perfectly fine reasons to write a layer on top of a framework, but please, for all future devs sanities, write fucking documentation and maintain it if you're going to use said framework in all major projects!!
Anyhow back to the situation at hand, I'm getting familiar with the project, sighing at the use of our stupid legacy framework, attempting to recreate the reported bugs...
Turns out I can't, well I get other bugs & errors, but not the reported ones. I go to the production server, where I suddenly do can reproduce them...
Already thinking, fuck my life, and scared for the results... I try a 'git status' on the production server....
And yep, there it is, lo and behold, fucking changes on production, that are not in git, fuck you previous dev who worked on this and your stupid lazy ass modifcations on production!
Bleh, already feeling royally pissed, there's only 1 thing I can do, push changes back to git in a seperate branch, and pray I can merge them back in master on my dev environment without to much issues...
Only I first have to get our sysadmi. to allow pushing from a production server back to our git server...
Sigh, going to put on my headphones, retreat to my me space and try to sort out this shitpile now... -
I came across a website today when I was searching for some banking related stuff on Google and this is what happened...
Types search term in Google
Gets the results
Opens a result in a new tab
Finishes reading it and clicks back
Tab refreshes to go the website's home page (What!?)
Clicks back again
Refreshes to the same result page (seriously?)
Back
Home page
Back
Result
Back
.
.
.
.
Back
Google home page (wtf?)
Back
Website home page (again?)
Back
Result page (NO! I'M DONE)
Closes the tab
What sort of wicked loop did I get myself into? Did the website devs ever think how frustrated it will be if they ever open their own page?
And what a clever technique to open Google home page for people who keep on pressing the back button! 👏👏 /s1 -
It's 2022 and web browsers are still unable to unfollow redirects.
If I open some URL in a new tab and it redirects me to /503.html or similar due to some server errors (which is bad design to begin with), there is no way to see which URL was redirected from. The "back" (←) navigation button is greyed out, so there is nowhere to go back to.
One might open a new tab to look at it later without realizing it redirected to an error page. Then one opens it, sees /503.html, and has forgotten which article one was going to read.
Only on the mobile edition of Chrome/Chromium, switching between desktop and mobile view unfollows the redirect. But on Firefox mobile, Chrome/Chromium-based desktop, and Firefox desktop, there is no way to know which URL redirected me there. -
New Pixel 4a arrived... Hate the defaults... Gestures... I guess at least there was an option to get the buttons back though had to figure out how to open Chrome and Google it.
Now I just need to really for like... The whole day for our to finish downloading 141 apps from backup... And well I'll prolly uninstall half of them...3 -
@dfox I think that it would be more comfortable to mark as viewed a notification once you open the notifications menu.
What I mean is that, you don't actually have to click on the notif, enter the rant, and get back to the menu to leave it as seen.
I find having to click on every notification very tedious4 -
Looking at code from previous devs...which I now support...
Oh hey there is a function to retry connecting to the database if it fails to open...ok...
It doesn't return anything e.g. a boolean. Not a big deal I'll catch the exception...
It catches the exception and silently ignores it? WTF how do I know if it fails??
It keeps trying for 20 seconds...sounds reasonable...wonder how long it waits between failed attempts...0. No sleep, no back off, literally spams the open call as quick as it can throw the exception...
I'm glad I personally dont know them. They are fucking idiots. -
Trying a custom eMbEdDeR today using open AI and pinecone on some douments of financial data. Let's see if its smart enough to be able to answer even the most basic questions, or if it just fumbles completely.
My bias is to be highly skeptical.
Will report back with results.14 -
I'm starting to get annoyed with Android Studio. I generally enjoy it as far as an ide goes, but why does it need to update so often??? Seriously it feels like every time I open it I get a notification saying to update something or other.
On a somewhat related note but not actually Android Studio's fault, I have decided that IdeaVim sucks. It's good sometimes, but it can't keep up with my keystrokes, so I end up with random characters in my code because even though I hit "jj" (remapped to ESC) then start typing other commands, I end up with the next command being read as still in insert mode, then it catches up with the escape and pops me back to normal mode. It drives me crazy because then I have to go back and undo the extra characters, then redo my command and it kills my flow. I'm not even that fast of a typist, it shouldn't be that hard to keep up... -
So I've been doing GSoC this summer (sort of a paid project for an open source org.), and have not made it to any milestones whatsoever, even with 10-12 hour days and almost no days off. The other GSoCcers in my organization are just doing amazing, so I wonder wtf is wrong with me. I got past the midterm because my mentor is amazing, but wtf, I fucking exhausted of trying so hard just to fall on the "slightly below average" mark. I'm 21 and I feel too old to do anything great aleady!!
Now I have to quit whining and get back to work.1 -
tldr: Deleted Win10, turned out for better
---------
**This happened a few months ago**
---------
So one day I decide I have had enough of Windows 10 and wanted to go back to Linux (A long time ago I had dual booted Ubuntu, but messed it up changing video drivers). So I create a Mint installation USB and get to work. I boot up the installation and delete the old partitions from the Ubuntu install. I install Mint and boot it up, everything works fine and dandy! I decide I want to get back on Windows to get back a few files that I wanted copies over. I turn off the computer and *try* to boot up Windows. I get an error message that I am UNABLE to boot. WHAT! After further checking, I realize that I had deleted the MBR partition of Windows. Pretty sure I could remake it if I tried hard enough, but I am starting to realize that it feels good to be totally MS independent! Now I am using all open-source software available to Linux and have no need for Windows. I do miss some of the games though...
PS: No files were lost due to backups. Save Lives, Do Backups! -
MQTT - all I used to know about this is its name, untill few months back a client sent us some requirements which included MQTT. I opened its specification and I was fucking shocked! I am implementing almost similar protocol in most of my applications (which needs subscription based service) for last 3 years. I have developed IoT apps, remote monitoring systems, HMI systems using the same fucking protocol! Even I had implemented the same thing on HTTP using long polling a few years back!!
Now I feel like open sourcing my protocol. But I don't know where to start. Any help please?1 -
Layoff wave in Germany.
There is a new open-source project on Github, willbeallright-COVID19 for engineers being recently layoff because of the COVID19 situation. The main aim is to help programmers to stay connected to job opportunities. Quite interesting as the main contributor mentioned immediate questions that should be asked after the notification, and it seems to be on point as even here I've seen people searching for that information like What about all the personal items you have on the company computer? How can you get this information back? She is looking for community support so if you have any experience with layoff might be an interesting project.1 -
I'd bring back ActionScript 3, make sure it is supported in all environments including iPhones, make swf files lighter in size, make adobe air a popular platform, basically I'd do everything to bring back AS3, even make it open sourced, so that Adobe doesn't make all the money.
-
So I interviewed with Yahoo for SDET position, hr said he would get back to me in couple of days and never responded. He knew that I had multiple offers, why the fuck would he not respond.
Finally, after couple of weeks I was able to get hold of him after calling like a million times and then he says that my profile is still under review. WTF?
why do they treat candidates like this? Facebook was so better, even though I couldn't go past the final round I found their interview process very open and felt they actually cared about me.
yahoo get your shit together. #yahoofail1 -
Is there any open / close source application that allows creating browser-based tutorials where the left side would have instructions and the right side section would have terminal to execute the code from the tutorial.
There would be a back-end server to execute the command from terminal and send back the result.
Here is the representative screen-shot:3 -
I had an idea for an open source project, but wanted to get some feedback before I committed a lot of time and energy to it. Seeing as how devRant is the only social media type app I use, I thought this would be a good place to ask.
The project would be an open source keyboard for iOS that would make it easier for devs to write code on their mobile devices. There's already a few "developer" keyboards, but they're either paid apps, or haven't been updated in a while.
Creating a custom keyboard isn't very complex, so it could be a good place for newer devs to actually contribute code and get comfortable with open source in general.
So my question is, do people use third party keyboards? Is this something people would be interested in contributing to? Should I go back to the drawing board?3 -
Baseball game
I love sports, the weather was fantastic and the crowd wasn't that loud. Kicked my feet back, cracked open a Yoohoo, turned on my light theme and went to work.
I'd do it again too. But that kinda weather isn't here yet. -
Ok so I had to make a revision on a PDF with JS that was being tested to fix some bugs, I hadn't touched it or Acrobat Reader for more than a month I think but I could work on it well back then.
I had to see the problem first so when I go and open it with Adobe Reader, it crashes. Weird. I can't get it to work.
Well I'm reinstalling it then.
After downloading the (now correct, I tried to use an old one I had and lost some time) installer, I tried to install it and it asked me to close Outlook and Excel. Weirder.
I do, and after finishing it said "you have a newer version, open it?". Super weird. Of course when I accepted it didn't work.
I uninstall my current installation and while uninstalling it asks me to close Chrome. Ok now I'm not ok with this shit.
Adobe wtf?
I needed to fix it in some minutes and it ended up taking hours.4 -
Does anyone else have problems with devRant? Whenever I exit a rant and go back to the 'main window', where the rants are supposed to be listed, I get an empty page (with the typical devRant background but without the loading animation). Rants won't load for me then.
Rants won't load for me except for the first time when I open the app. After I clicked on a rant and go back, it won't load.
Using a OnePlus 3 with Android 7.1.1, in case that matters. :)6 -
So i'm currently working on my PiStation..
(look at my previous post if you're interested)
I'm imaging over RetroPie over to the SD card, screw back together the housing, and it boots up fine. As soon as i configured my XBOX-controller i got to the wifi-settings. And when i try to access my wifi, guess what, it doesn't connect to my f**kin wifi. So i double check my wifi-settings in the router i just bought to get over my roommates paranoia (that's a whole another story. Just in short, he's got no idea of IT-security and tries to be an admin, which results in a HUGE amount of bulls**t), confirm that the settings are alright, double check the PSK too, anything is fine. So i go through the whole process again, download the image (from their goddamn slow servers), open up the PiStation, image it over to the SD card, close it back up, anything boots up fine and works, except this f**king wifi. And the thing is, i COULD connect it with a patchcable, but i dont want cables going anywhere through my room. Currently imaging over recalbox OS, will keep you updated. I just want to play some old retro games ._.2 -
Going through some code I was handed to do an emergency project... Think of an aspx site that follows no design rule, like database access directly in the code behind. No models ect. So I'm going through this section that calls a function good start. Open the function find a class that contain code to access the database.. Humm ok this part look better that the rest. Read the code that validates if it exist in the database and gets the type back. So far so good then there is a get details function call.... Open up the fct ... Started crying... There is a 200+ lines switch case that goes over the type previously fetched..... And the type is stringed compare in the biggest switch case I've ever seen.... Fthis... I'm out1
-
Paid brain.js for some time already because it is so awesome that I feel bad not to.
Then this is a random day that I want to know more about the back story of it, turns out the original author @harthur had such a bad experience on the open source world.
Double-downing on this is that she singlehandedly made 3 of my most favourite packages which is too cute to forget since Node.js has came about.
My gawd, what have people done?1 -
I’m in the process of doing interviews and company A seems to like me - however company B just booked an interview for me. If company A calls me back for a job offer, what’s a reasonable time frame to give them my final answer?
Just in case, I want to keep my options open for company B depending on their offer.1 -
As back end developer, I rarely have hands on production environment. When it happens, I need to ask my way around and since the office is empty that day, I ask the client directly. They give me a URL. Right away, I ask the credentials.
"Just connect to the URL"
"You mean, you have an open access of this software, having critical information of more than 50 000 persons, to the web?"
*Silence* "hahaha it appears that way"
Thankfully, a tactful manager handled the situation astutely and we never heard about it anymore.
Don't we love all happy ending? -
I just had a discussion with a customer a week ago. He tould me that the PDF Files we are having in our application are not showing Up.
Connected to his computer to look at the problem just to find out That Google Chrome is blocking the popup. I tell him the problem and once He allows it to open it wont happen again.
Customer: I dont want That it also happens to my customers and they dont know that either. Just fix it and call me back" I try to explain him That we cant just change thr behaviour of the Browser but He already hung Up.
Well i guess we are going to buy Google the next week to change his Problem xD2 -
So first day in the course (https://devrant.com/rants/2049071/...), the lecturer want's to tell us a joke but forgets the punchline...
While he is trying to remember, everyone is like "let's Google it" And proceed to open their phones.
So someone in the back says, what are you guys? Geeks? Let's duck it!3 -
He's just some Forex trader with no clear major
Call him the savior like born in a manger
Hit me on my pager, get back to you later
Handcannon, pockmarks, face full of craters
What's a man to do in a world like this?
Live my whole life to get burnt to a crisp
They open their mouth to regurgitate shit
With some coins in my fist, a .45 on my hip
cult rap hits different -
Be me.
Writing a java class for uni work, that'll eventually run on android.
I get kicks from making functions work using as few steps as possible, using minimal code.
Explain to someone how I'm doing it.
I learn that loops and the rest of it generate more code and take longer than unwrapping the loop and writing every case manually.
Shit ffs I spend hours making my code more concise :(
Then, I'm told the recursive method I'm using for checking for a win is too complicated, that I shouldn't start looking for a win from the last counter I placed, but should scan the WHOLE board for a win in every angle.
Eat my food, open my beer, pet my dog, trundle off back to work. -
i'm sitting on the bus a few years ago, slamming the keyboard on my chromebook to try and get a wifi password. open crosh by accident. i went to check it out for a few days. i check back a few years later, every tab (basically everything for CrOS) autocloses if it has "crosh" in the url (regardless if it's crosh or not.) this pisses me off. i tell my brother about it, and he gets the terminal running for one day. how? i still dont know, sadly the program he installed (a harmless music notation app) breaks as well as the terminal. to this day i still wonder about what our IT department was thinking.
-
Sober me: *stopping working on code fully documented with comments* let's take a break.
Drunk me: * stumbles across still open code* psh what a nerd *deletes comments*
Sober me: * sitting back down* okay where was I... For the love of!
Drunk me is a dick to sober me. Need to lock stuff up better....3 -
I was looking for a RRule Generator Component in ReactJS because I (a back-end dev) am lazy af to build front-end component. It drains my energy and I stumbled upon "react-rrule-generator". And holy moly. It is no longer maintained, but it has a very beautiful code. Then I thought, I should search more open source projects where code is clean so I can learn more.
So, do any of you know any open source project, library code or whatever that you think has a very clean code?3 -
if rotation is enabled and you open a rant keeping your phone in landscape position, app goes landscape for no reason and comes back to portrait.1
-
I do this often to unsuspecting colleagues. I take a screenshot of whatever work they were doing and open it in the photo viewer, fullscreen. They'd then come back and wonder for a while how their computer suddenly froze.
-
I’m excited to be a speaker at Bridges Summit on August 28th, and will be leading a community discussion! Bridges Summit is a free virtual event that bridges research and industry communities, leading a collaborative open source initiative to reframe “Developer Productivity”. We’re taking a step back to think about what we are aiming for, and bringing clarity to that vision with the power of collaboration, and the wisdom from all of our years of experience.
Come join us for an amazing community discussion around this important topic.
https://bridges-summit.org/speakers... -
Today after the week and a lesson time in an high-school I got back home and decided to play some sacred 2
I had already installed some mods on it given that I have already finished it years ago and I wanted some challenge.
It ends up that the mods add too much difficulty, so I open up the configuration files of the mod (some sort of Lua tables) and then spend like an hour and half doing some reverse engineering on it to find a middle way between the vanilla and the Uber difficult mod
Wow! -
If I press the attach image dialogue in the devRant android app, then don't select anything and back out instead, the app shits itself. Takes ages to respond, I usually just go to the task switcher and dismiss the task and open the app again.
Anyone else?
s10, android 11.
And if so, could someone else raise an issue on github? I don't want to associate this profile with anything that's demonstrably me.12 -
Jira on Android 🙄
I had an overview of the backlog, blocked, active issues, could see who works on what and so on ...
Accidentally pressed the back button, returned to the project. Now it's a single big list with only issue type, description and deadline. It's pretty much a guessing game, which feature is open. Their seems to be no way to change that, not even deleting any data.
How did this happen?? Let me change it back!6 -
@retoor
The beauty of vim is that I'm using it either bare or within vscode for ever (I think it was back in montreal when i was unemployed, or maybe in ireland, cant even remember), and I'm still learning.
You can jump through file by using caps mark.
do MD, open another file (i use fzf) and then you can come back using 'D. This is fucking great and i feel very stupid for not knowing it.
I just wish i could use vim within firefox11 -
Having a dilemma... I need help with my gaming projects. I know a guy who I could train since he has lots of potential but Im having trust issues. Its because I invested around 10k into my codebase and Im afraid to give access to that guy since I suspect that he might use files and some day run away to make his own project. So im back to square 1 again which is loosing my mind with this huge workload. What should I do? Should I just say fuck it ant make him sign some air tight NDA agreement? Even then he could stand up and leave 2 months in and open a competitor project if he doesnt like my management style...3
-
!rant
Does ayone knows of a
+ Good
+ Open Source
+ Free
Data test generator tool?
I'm on my first work with a development that will go to production, and I'd like to test performance, UI and all of that with random generated data. I know about dbSchema but it's trial pulls me back -
Feature not a bug...
My work laptop has started rebooting almost every night.
It's not clear why, but I sort of think of it as a feature now.
I have an ultra-wide monitor, plus another wide next to that one, and a bunch of virtual desktops.
I often think "ok everything is where it is that's good" but coming in reality with a bazillion things open across all the desktops and screens sometimes when I come back the next day ... it's actually just a lot of mess / overhead to pick up where I was.
Sometimes I think we introduce a lot of complexity to solve a problem and ... actually it's just more complexity if you're not already 8 layers deep.5 -
How (generally) do offer different persistence layers for an app?
So, I have used lots of apps (sorry, I'm talking a proper software system such as a Web based service (e.g. The Open Source XMPP server 'Openfire') in which you can choose what persistence back end you want (MySql or inbuilt H2/SQL light for example).
Within your code, how do you go about achieving this? Would you delegate the persistence to a separate class, and within that class figure out what the systems settings are and use the right connection string?
I'm currently using Java, Hibernate and would like to offer back ends of MySql, H2 and Redis, but the question is more conceptual than specific.
Many thanks. -
Illusion of interactivity: switching back to a tab with an open google document in google docs, I see a cursor, but it's not yet accepting input, only after I click anywhere inside the document. Might be due to lazy loading browsers tabs, but anyway this is irritating.1
-
@dfox I have a strange behaviour. Don't know if it's just me. But when I Click on a rant to open it on "a new window" and I give the rant a "++" and go Back afterwards, the plus icon on the specific rant changed the Color to Red but the counter didn't changed. When I Click the rant again, the counter and the Color is correct. But if I go Back again, only the Color remains, not the counter.
Does anybody else made this experience?
Thanks in advance.2 -
Any ASP.NET Core experts here? I'm using the localization code found from asp.net core documentation and it works fine except that if I let the browser open and idle for like 15 minutes and then refresh the page it always returns an english version. If I refresh again it goes back to the chosen language and works as long as I use it. Same thing locally and on server. Any ideas what this could be related to? I'm lost :(
-
I used parse-server and services back when it was a web service at an internship, just loved the way it did things it did. Backend as a service was new to me as a mobile application developer. 5 years down the lane. My first go-to backend is Parse. I know firebase does XYZ things better. But I love the simplicity and openness of parse.
Community picked up parse as a self hosted open source service and its still going strong.
Just love the possibility of starting a mobile project and not having to worry about setting up a whole web service to cater to it. -
I'm troubled by the stuff I made back when I did not know how I should use Unity's Animator. I have these animators that open and close a dialog with transition effects, but I used Triggers to accomplish it. With Triggers, no matter how I construct it, it seems that there is always this weird edge case that can only happen if Triggers are spammed.
Why I did not use Bools for open/close state is beyond me. And I have tons of those Animators to fix. FML.